Recombinant Bacteroides fragilis UPF0365 protein BF1143 (BF1143)

What are the optimal conditions for expressing and purifying recombinant BF1143 protein?

For optimal expression and purification of recombinant BF1143 protein, researchers should follow this methodological approach:

• Expression System Selection: The E. coli expression system has been validated for successful production of BF1143 with N-terminal His tag .

• Purification Protocol: Utilize affinity chromatography with Ni-NTA columns for initial purification, followed by size exclusion chromatography to achieve purity greater than 90% as determined by SDS-PAGE .

• Storage Recommendations:

  • Store the purified protein at -20°C/-80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

• Buffer Optimization: Maintain in Tris/PBS-based buffer with 6% Trehalose, pH 8.0 for optimal stability .

• Working Aliquots Management: Store working aliquots at 4°C for up to one week to maintain protein integrity .

How should researchers design experiments to investigate potential interactions between BF1143 and host immune systems?

When designing experiments to investigate BF1143-host immune interactions, researchers should implement a multi-level experimental approach:

• Initial in vitro screening:

  • Expose human immune cell lines (macrophages, dendritic cells) to purified BF1143

  • Measure cytokine production (IL-6, TNF-α, IL-10) via ELISA

  • Assess cell surface activation markers using flow cytometry

• Serum resistance assays:

  • Compare wild-type and BF1143-knockout strains in normal human serum killing assays

  • Follow protocols similar to those used for studying O-antigen variation effects on serum resistance

  • Include appropriate controls such as the HCBf084 strain (known to be highly resistant to serum killing)

• Co-immunoprecipitation studies:

  • Identify potential host protein binding partners

  • Use tagged versions of BF1143 to pull down interacting host proteins

  • Confirm interactions with reciprocal pull-downs

• Comparative analysis:

  • Design experiments with multiple B. fragilis strains from different phylogroups

  • Include both commensal and known pathogenic strains

  • Use statistical methods to correlate BF1143 sequence/expression variations with virulence phenotypes

• Control considerations:

  • Include technical replicates (minimum three) for each experimental condition

  • Document all experimental steps with detailed diagrams for reproducibility

  • Include a final cleanup step in all procedures

What approaches can be used to determine the membrane localization and topology of BF1143?

To determine the membrane localization and topology of BF1143, researchers should employ the following complementary approaches:

• Computational prediction analysis:

  • Utilize transmembrane prediction algorithms (TMHMM, MEMSAT, Phobius)

  • Apply signal peptide prediction tools (SignalP)

  • Generate a hydropathy plot to identify potential membrane-spanning regions

  • Based on the amino acid sequence, BF1143 contains hydrophobic regions in its N-terminus (MNVEPMYLTIFLIAGGIIFLVLFFHYVPFFLWLSAK) suggesting potential membrane association

• Biochemical fractionation methods:

  • Separate B. fragilis cellular components into cytoplasmic, periplasmic, inner membrane, and outer membrane fractions

  • Detect BF1143 in fractions using specific antibodies or by tracking His-tagged recombinant protein

  • Compare localization with known membrane protein markers

• Fluorescence microscopy:

  • Generate fusion proteins with fluorescent tags (GFP/mCherry)

  • Visualize localization in B. fragilis or heterologous expression systems

  • Use co-localization studies with known membrane markers

• Protease accessibility assays:

  • Treat intact cells, spheroplasts, or membrane vesicles with proteases

  • Analyze protected fragments to determine topology

  • Compare results with predicted topology models

• Cysteine scanning mutagenesis:

  • Introduce cysteine residues at different positions

  • Test accessibility to membrane-impermeable sulfhydryl reagents

  • Map exposed versus protected regions

How can researchers investigate potential flotillin-like functions of BF1143 in membrane organization?

Given that BF1143 is also known as "Flotillin-like protein FloA," researchers should use these approaches to investigate its flotillin-like functions:

• Membrane domain isolation:

  • Use detergent-resistant membrane (DRM) extraction protocols

  • Analyze distribution of BF1143 in DRM versus soluble fractions

  • Compare with distributions of known flotillin proteins from other bacterial species

• Protein-protein interaction studies:

  • Perform pull-down assays with tagged BF1143

  • Utilize bacterial two-hybrid systems to screen for interacting partners

  • Conduct cross-linking experiments followed by mass spectrometry

  • Focus on potential interactions with membrane proteins and components of secretion systems identified in pathogenic B. fragilis strains

• Genetic knockout/complementation:

  • Generate BF1143 deletion mutants in B. fragilis

  • Assess changes in membrane organization, protein secretion, and pathogenicity

  • Complement with wild-type and mutant versions of BF1143

  • Measure alterations in susceptibility to antimicrobials, bile salts, and serum killing

• Lipid interaction analysis:

  • Utilize lipid overlay assays to identify specific lipid interactions

  • Perform liposome binding experiments with purified BF1143

  • Analyze effects of BF1143 on membrane fluidity using fluorescence anisotropy

• Electron microscopy studies:

  • Utilize immunogold labeling to visualize BF1143 distribution

  • Examine membrane ultrastructure in wild-type versus knockout strains

  • Look for alterations in membrane invaginations or microdomains

How does BF1143 expression vary across different phylogenetic groups of B. fragilis, and how might this correlate with pathogenic potential?

To investigate BF1143 expression variation across B. fragilis phylogenetic groups:

• Comparative transcriptomics approach:

  • Analyze BF1143 expression across the 16 identified phylogenetic groups of B. fragilis

  • Compare expression levels between commensal and pathogenic isolates

  • Correlate expression with presence of known virulence factors like the bft toxin gene, T6SS GA3 system components, and O-antigen synthesis genes

  • Perform qRT-PCR validation of expression differences in representative strains

• Regulatory context analysis:

  • Examine promoter regions of BF1143 across different strains

  • Identify potential transcription factor binding sites and regulatory elements

  • Test if BF1143 expression responds to environmental cues associated with pathogenicity (oxygen tension, bile salts, host-derived signals)

• Correlation with phylogenetic distribution:

  • Construct a table comparing BF1143 sequence variation and expression across the 16 phylogroups

  • Highlight correlations with pathogenic traits

• Functional implications assessment:

  • Test if BF1143 variants from different phylogroups complement function in knockout strains

  • Evaluate if BF1143 expression correlates with O-antigen variation and serum resistance

  • Investigate potential interactions with the ubiquitin homolog BfUbb, which is more abundant in extra-intestinal strains

What role might BF1143 play in B. fragilis adaptation to different host environments?

To investigate BF1143's potential role in host adaptation:

• Environmental response profiling:

  • Measure BF1143 expression under conditions mimicking different host environments:

    • Varying oxygen levels (aerobic, microaerobic, anaerobic)

    • Different pH conditions (stomach, small intestine, colon)

    • Presence of bile acids and host defense molecules

    • Nutrient limitation scenarios

• Host cell interaction studies:

  • Compare wild-type and BF1143-deficient strains for:

    • Adhesion to different epithelial cell types

    • Invasion capabilities

    • Survival within macrophages

    • Biofilm formation on host surfaces

• In vivo colonization experiments:

  • Utilize animal models to assess:

    • Gut colonization efficiency

    • Persistence during antibiotic treatment

    • Competitive index against other strains

    • Ability to translocate across gut barrier

• Stress response analysis:

  • Evaluate the contribution of BF1143 to tolerance of:

    • Oxidative stress (relevant to inflammatory environments)

    • Antimicrobial peptides

    • Complement-mediated killing

    • Temperature fluctuations

• Comparative genomics integration:

  • Correlate BF1143 variations with isolation source (commensal versus extra-intestinal)

  • Analyze if BF1143 co-occurs with specific polysaccharide utilization loci (PULs) or bile salt hydrolases that may facilitate host adaptation

How can factorial experimental designs be applied to study the interplay between BF1143 and other B. fragilis virulence factors?

Factorial experimental designs offer powerful approaches for studying complex interactions between BF1143 and other virulence factors:

• Design structure implementation:

  • Utilize 2×2×2 factorial designs with these potential independent variables:

    • BF1143 expression (wild-type vs. knockout)

    • BFT toxin expression (positive vs. negative)

    • T6SS GA3 system (functional vs. non-functional)

  • Measure multiple dependent variables:

    • Epithelial barrier disruption

    • Inflammatory cytokine production

    • Serum resistance

    • Intracellular survival

• Statistical analysis framework:

  • Apply ANOVA to determine main effects and interaction effects

  • Utilize post-hoc tests to identify specific significant differences

  • Calculate effect sizes to determine the relative contribution of each factor

• Balanced approach to ecological validity:

  • Design experiments that balance laboratory control with real-world relevance

  • Include conditions that mimic the gut environment

  • Consider host genetic factors as blocking variables

• Data interpretation guidelines:

  • Focus on interaction effects that may reveal synergistic or antagonistic relationships

  • Compare results across different host cell types or animal models

  • Interpret findings in the context of B. fragilis phylogenetic groups

What approaches can researchers use to resolve potential data contradictions when studying BF1143 in different experimental systems?

Addressing data contradictions when studying BF1143 requires systematic troubleshooting and methodological refinement:

• Contradiction identification protocol:

  • Document all experimental conditions precisely

  • Create a comprehensive table of contradictory results across systems

  • Analyze variables that differ between experimental setups:

    • Bacterial strain backgrounds

    • Expression systems

    • Host cell types

    • Environmental conditions

• Validation through methodological triangulation:

  • Apply multiple independent techniques to measure the same phenomenon

  • For example, if protein-protein interactions show discrepancies:

    • Validate with yeast two-hybrid, co-immunoprecipitation, and FRET

    • Compare results with computational predictions

    • Develop in vitro binding assays with purified components

• Strain-specific effects investigation:

  • Test hypotheses across multiple B. fragilis isolates from different phylogroups

  • Consider genetic background effects by:

    • Creating isogenic strains differing only in BF1143

    • Introducing BF1143 variants into a standard laboratory strain

    • Using CRISPR-Cas9 to make precise genetic modifications

• Environmental context consideration:

  • Systematically vary experimental conditions to determine:

    • Temperature effects

    • Growth phase dependencies

    • Media composition influences

    • Oxygen level impacts

• Reproducibility enhancement:

  • Develop standardized protocols with detailed procedure diagrams

  • Establish positive and negative controls for each assay

  • Perform blind analysis when possible

  • Pre-register experimental designs and analysis plans

How can advanced computational methods enhance our understanding of BF1143 structure-function relationships?

Advanced computational methods offer powerful tools for elucidating BF1143 structure-function relationships:

• Protein structure prediction pipeline:

  • Apply multiple approaches:

    • Homology modeling using known flotillin structures as templates

    • Ab initio modeling with AlphaFold2 or RoseTTAFold

    • Molecular dynamics simulations to assess structural stability

    • Predict post-translational modifications and their impact

• Functional domain analysis:

  • Identify conserved domains through multiple sequence alignments

  • Compare with characterized flotillin proteins from other organisms

  • Map sequence variations observed across B. fragilis phylogroups to structural models

  • Predict functional consequences of amino acid substitutions

• Molecular docking simulations:

  • Predict interactions with:

    • Membrane lipids

    • Protein partners identified in experimental studies

    • Host immune system components

    • Antimicrobial compounds

• Network analysis integration:

  • Place BF1143 within the context of B. fragilis protein-protein interaction networks

  • Integrate with transcriptomic data to identify co-regulated genes

  • Compare network positioning in commensal versus pathogenic strains

  • Identify potential regulatory connections to virulence systems

• Machine learning applications:

  • Develop predictive models for:

    • BF1143 function based on sequence variations

    • Contribution to pathogenicity

    • Interactions with host systems

  • Validate computational predictions with targeted experiments