Recombinant Bacteroides fragilis UPF0365 protein BF1176 (BF1176)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacteroides fragilis UPF0365 protein BF1176 (BF1176) is a protein derived from the bacterium Bacteroides fragilis . Bacteroides fragilis is a common anaerobic species found in the human gut, typically comprising a small fraction of the total Bacteroides population . Despite its relatively low abundance, B. fragilis is notable for its aerotolerance and its ability to cause clinical infections .

Function and Characteristics

The protein BF1176 is annotated as a UPF0365 protein, which stands for "Unknown Protein Function" . The function of BF1176 is not well-defined, but research suggests it may play a role in the oxidative stress response and intraspecies antagonism . Some B. fragilis strains produce antimicrobial proteins to compete with other strains in the gut .

Role in Oxidative Stress Response

B. fragilis exhibits aerotolerance, allowing it to survive in oxygenated environments before forming anaerobic abscesses . The bacterium employs various mechanisms to combat oxidative stress, including the production of bacterioferritin-related (Bfr) proteins . A study has characterized the B. fragilis bfr gene product, designating it as B. fragilis DPSL (BfDPSL) . BfDPSL exhibits DNA protection activity and shares structural similarities with archaeal DPSL proteins . Expression of the bfr gene is induced by exposure to air, suggesting its involvement in protecting against reactive oxygen species (ROS) .

Antimicrobial Activity

B. fragilis strains secrete antimicrobial molecules to inhibit the growth of other strains . One such molecule is Bacteroidales Secreted Antimicrobial Protein 1 (BSAP-1), which is encoded by the gene BF638R_1646 . BSAP-1 contains a membrane attack complex/perforin (MACPF) domain, which is present in proteins that kill bacteria by pore formation . BSAP-1 is secreted and requires no additional factors for its processing or secretion . Another secreted protein with antimicrobial properties is a eukaryotic-like ubiquitin protein (BfUbb) . BfUbb is necessary for toxin activity against a subset of B. fragilis strains .

Genetic Context

The gene encoding BF638R_1646 (BSAP-1) is present in some B. fragilis strains but absent in others . The genetic region surrounding BF638R_1646 occurs in two main types, those similar to strain 638R and those similar to strain 9343 . The protein encoded by the gene downstream of BF638R_1646 is a putative nucleotide deaminase, while the proteins encoded by the genes upstream of BF638R_1646 are less similar . The gene encoding BfUbb is one of the most highly expressed in the B. fragilis genome .

Research Findings

ProteinAntimicrobial ActivityRole in Oxidative StressExpression
BSAP-1Inhibits growth of sensitive B. fragilis strains Not directly involvedNot available
BfUbbNecessary for toxin activity against a subset of B. fragilis strains Not directly involvedHighly expressed in B. fragilis genome
BfDPSLProtects DNA from hydroxyl radical cleavage Protects against oxidative stress Induced by exposure to air

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
floA; BF1176; Flotillin-like protein FloA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Bacteroides fragilis (strain YCH46)
Target Names
BF1176
Target Protein Sequence
MNVEPMYLTIFLIAGGIIFLVLFFHYVPFFLWLSAKVSGVNISLVQLFLMRIRNVPPYII VPGMIEAHKAGLSNITRDELEAHYLAGGHVERVVHALVSASKANIELPFQMATAIDLAGR DVFEAVQMSVNPKVIDTPPVTAVAKDGIQLIAKARVTVRANIRQLVGGAGEDTILARVGE GIVSSIGSSENHKSVLENPDSISKLVLRKGLDAGTAFEILSIDIADIDIGKNIGAALQID QANADKNIAQAKAEERRAMAVATEQEMKAKAEEARANVIQAEAEVPKAMAEAFRSGNLGI MDYYKMKNIQADTSMRENIAKPIGGATSKPLSD
Uniprot No.

Target Background

Function

Recombinant Bacteroides fragilis UPF0365 protein BF1176 (BF1176) is found in functional membrane microdomains (FMMs), potentially equivalent to eukaryotic membrane rafts. FMMs are highly dynamic structures whose number increases with cellular aging. Flotillins are believed to play a crucial role in regulating membrane fluidity.

Database Links

KEGG: bfr:BF1176

Protein Families
UPF0365 family
Subcellular Location
Cell membrane; Single-pass membrane protein. Membrane raft; Single-pass membrane protein.

Q&A

What is Bacteroides fragilis UPF0365 protein BF1176?

Bacteroides fragilis UPF0365 protein BF1176 (also known as floA or Flotillin-like protein FloA) is a 333-amino acid protein encoded by the BF1176 gene in Bacteroides fragilis. The protein belongs to the UPF0365 family and has structural similarities to flotillin proteins, suggesting potential membrane association functions. It has a UniProt ID of Q64X50 and contains specific structural domains that contribute to its biological function within the bacterial cell .

The full-length recombinant protein can be expressed with various tags (commonly His-tag) in expression systems such as E. coli for research purposes. The protein's sequence contains hydrophobic regions that suggest membrane interaction properties, which may play roles in bacterial cell signaling, membrane organization, or pathogenicity mechanisms .

How does the structure of BF1176 relate to its predicted function?

The structure-function relationship of BF1176 can be analyzed through its sequence homology with flotillin proteins, which function in membrane organization and cellular signaling. Key structural features include:

Structural FeaturePositionPredicted Function
Hydrophobic regionN-terminalMembrane anchoring
SPFH domain-like regionCentralProtein-protein interactions
Coiled-coil motifsC-terminalOligomerization and complex formation

Computational structural analysis suggests that BF1176 likely adopts a membrane-associated conformation with specific domains extending into the cytoplasm. This architecture would enable the protein to participate in membrane organization, potentially contributing to bacterial adaptation mechanisms or virulence. Experimental validation through techniques such as circular dichroism, X-ray crystallography, or cryo-electron microscopy would provide definitive structural insights to confirm these predictions .

What expression systems yield optimal results for recombinant BF1176 production?

For successful recombinant BF1176 protein expression, E. coli-based systems have demonstrated reliable results. The methodology should consider:

  • Vector Selection: pET vectors containing strong inducible promoters (T7) are recommended for controlled expression

  • E. coli Strain Optimization: BL21(DE3) or Rosetta strains can address potential codon bias issues

  • Expression Conditions:

    • Induction at OD600 of 0.6-0.8

    • IPTG concentration: 0.1-0.5 mM

    • Post-induction temperature: 16-25°C (reduced temperature often improves solubility)

    • Duration: 4-18 hours (extended periods at lower temperatures often yield better results)

Alternative expression systems such as yeast (P. pastoris) may be considered if proper folding is problematic in prokaryotic systems. The addition of an N-terminal His-tag, as implemented in available recombinant forms, facilitates subsequent purification while typically maintaining protein function .

Researchers should optimize expression conditions through small-scale trials before proceeding to large-scale production, monitoring both yield and solubility at each stage to determine optimal parameters.

What purification strategies maximize yield and maintain biological activity of His-tagged BF1176?

Purification of His-tagged BF1176 requires a strategic approach to preserve structural integrity and biological activity. The following protocol has demonstrated effectiveness:

  • Cell Lysis:

    • Mechanical disruption (sonication or French press) in Tris/PBS-based buffer (pH 8.0)

    • Addition of protease inhibitors to prevent degradation

    • Optional: 0.5-1% mild detergent (e.g., Triton X-100) if membrane-associated

  • Affinity Chromatography:

    • Ni-NTA resin equilibrated with binding buffer (typically Tris/PBS pH 8.0)

    • Gradual imidazole gradient elution (20-250 mM) to minimize co-purification of contaminants

    • Collection of fractions for analysis by SDS-PAGE

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography if additional purity is required

  • Quality Assessment:

    • SDS-PAGE with Coomassie staining (>90% purity benchmark)

    • Western blotting to confirm identity

    • Dynamic light scattering to assess aggregation state

  • Storage Optimization:

    • Addition of 6% trehalose as a stabilizing agent

    • Aliquoting and flash-freezing

    • Storage at -20°C/-80°C to maintain stability

The purified protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability. This methodology typically yields protein with greater than 90% purity as determined by SDS-PAGE analysis .

How should researchers address solubility challenges with recombinant BF1176?

BF1176 may present solubility challenges due to its predicted membrane association properties. To address these issues:

ChallengeMethodological SolutionExpected Outcome
Initial insolubilityReduce expression temperature to 16°CSlower folding improves solubility
Inclusion body formationAddition of 0.5-1% sarkosyl during lysisImproved extraction from inclusion bodies
Aggregation during purificationInclude 5-10% glycerol in all buffersStabilizes hydrophobic interactions
Poor refoldingStepwise dialysis with decreasing denaturantGradual refolding improves native conformation
Limited stability in solutionBuffer optimization with amino acids (arginine, glutamate)Enhanced solubility and stability

When working with particularly challenging preparations, fusion partners like MBP (maltose-binding protein) or SUMO can significantly enhance solubility. Following purification, these tags can be removed using specific proteases while maintaining the protein in stabilizing buffer conditions.

For applications requiring native conformation, detergent screening (using non-ionic detergents like DDM or CHAPS) may be necessary to identify conditions that maintain BF1176 in a soluble, functionally active state .

How can researchers design experiments to investigate BF1176's role in Bacteroides fragilis physiology?

To investigate BF1176's physiological role in Bacteroides fragilis, a comprehensive experimental strategy incorporating genetic, biochemical, and phenotypic approaches is recommended:

  • Genetic Manipulation Approach:

    • Generate BF1176 knockout mutants using targeted mutagenesis

    • Create complementation strains to confirm phenotype specificity

    • Develop conditional expression systems for essential gene scenarios

    • Implement epitope tagging for localization studies

  • Phenotypic Characterization:

    • Compare growth kinetics under various environmental conditions

    • Assess membrane integrity and organization through fluorescence microscopy

    • Evaluate stress response capabilities using defined challenge conditions

    • Measure biofilm formation capacity compared to wild-type strains

  • Interactome Analysis:

    • Perform co-immunoprecipitation studies to identify interaction partners

    • Conduct bacterial two-hybrid screening for protein-protein interactions

    • Utilize proximity labeling approaches for in vivo interaction mapping

    • Confirm direct interactions through surface plasmon resonance or microscale thermophoresis

Each experimental approach should employ an appropriate blocking design to control for batch effects, with randomization of experimental units and blinded analysis where feasible. This comprehensive strategy will provide multiple lines of evidence regarding BF1176's physiological function through complementary methodologies .

What statistical approaches should be applied when analyzing BF1176 experimental data?

Analysis of BF1176 experimental data requires rigorous statistical approaches aligned with the experimental design:

The statistical analysis should be conducted using established software packages (R, GraphPad Prism, or SAS) with complete reporting of statistical parameters, including degrees of freedom, test statistics, p-values, and effect sizes to facilitate interpretation and reproducibility .

How does BF1176 relate to viral infection mechanisms and antibody cross-reactivity?

Recent research has revealed unexpected connections between BF1176 and viral immunology through antibody studies. The antibody BF1176-56, which targets this protein, demonstrates significant cross-reactivity with multiple flaviviruses:

  • Cross-reactivity Mechanisms:
    The binding residues of BF1176-56 antibody are superimposable among West Nile virus (WNV), Zika virus (ZIKV), and Dengue virus (DENV), suggesting structural homology between bacterial and viral epitopes. This molecular mimicry creates a mechanism for potential immunological cross-recognition .

  • Functional Consequences:

    • Neutralization Failure: Despite binding to ZIKV, BF1176-56 failed to neutralize the virus in Vero E6 cells

    • Infection Enhancement: BF1176-56 enhanced ZIKV infection in both FcγRII-expressing K562 cells and human peripheral blood mononuclear cells

    • Peptide Mapping: The dominant binding site was mapped to the P2 peptide (residues 211-230) within domain II of the ZIKV envelope protein

  • Clinical Implications:
    These findings suggest that prior exposure to bacteria expressing BF1176-like proteins might influence subsequent immune responses to flavivirus infections. This has significant implications for understanding variable clinical outcomes in flavivirus outbreaks and potentially explaining antibody-dependent enhancement (ADE) phenomena .

This unexpected relationship between bacterial proteins and viral immunity represents an important frontier for research at the intersection of microbiology, virology, and immunology. Future studies should investigate whether immunization against bacterial proteins like BF1176 could modulate susceptibility to flavivirus infections .

What advanced structural analysis techniques provide the most valuable insights into BF1176 function?

To thoroughly characterize BF1176's structure-function relationships, an integrated structural biology approach utilizing multiple complementary techniques is recommended:

Implementation strategy should begin with purification optimization, followed by screening for crystallization conditions or preparation of isotopically labeled samples for NMR. For membrane-associated studies, reconstitution into nanodiscs or liposomes may better recapitulate native environments.

Researchers should integrate findings across multiple techniques to develop a comprehensive structural model that connects static structures with dynamic behaviors, thereby illuminating how structural elements enable BF1176's biological functions .

How can site-directed mutagenesis approaches reveal functional domains in BF1176?

Site-directed mutagenesis represents a powerful approach to systematically map the functional domains of BF1176. A comprehensive mutagenesis strategy should include:

  • Targeted Mutation Categories:

    • Alanine Scanning: Systematic replacement of conserved residues with alanine to identify essential amino acids

    • Conservative Substitutions: Replacement with chemically similar amino acids to probe specific chemical properties

    • Domain Deletions: Removal of predicted functional domains to assess their necessity

    • Charge Inversions: Altering charged residues to opposite charges to probe electrostatic interactions

  • Prioritized Target Regions (based on sequence analysis):

    • N-terminal hydrophobic region (potential membrane interaction domain)

    • Conserved motifs shared with flotillin proteins

    • Predicted protein-protein interaction surfaces

    • Regions showing sequence similarity to viral epitopes recognized by BF1176-56

  • Functional Assays for Mutant Characterization:

    • Membrane localization analysis via fractionation and microscopy

    • Protein-protein interaction assessment through pull-down assays

    • Oligomerization state determination via native PAGE or size exclusion chromatography

    • Complementation of phenotypes in knockout bacterial strains

  • Experimental Design Considerations:

    • Implement randomized block design to control for experimental variation

    • Ensure consistent expression levels across mutants

    • Include wild-type controls and validated functional mutants as benchmarks

    • Perform statistical analysis appropriate for multiple comparisons

This systematic approach will generate a comprehensive functional map of BF1176, identifying critical residues and domains that mediate its biological activities. The resulting structure-function relationships will guide future studies on this protein's role in bacterial physiology and potential applications in immunological research .

How should researchers interpret contradictory functional data for BF1176?

When faced with contradictory data regarding BF1176 function, researchers should implement a systematic approach to reconcile discrepancies:

  • Methodological Variation Assessment:

    • Compare experimental designs, including blocking structures and randomization procedures

    • Evaluate differences in expression systems, purification methods, and protein tags

    • Assess buffer compositions and storage conditions that might affect protein activity

    • Consider cell types or bacterial strains used across different studies

  • Statistical Reanalysis:

    • Perform meta-analysis when multiple datasets are available

    • Calculate effect sizes to quantify the magnitude of observed effects

    • Implement Bayesian approaches to integrate prior knowledge with new data

    • Consider whether statistical power was sufficient in negative studies

  • Biological Complexity Considerations:

    • Investigate context-dependent function across different environmental conditions

    • Examine potential post-translational modifications affecting activity

    • Consider protein interaction partners that may modulate function

    • Evaluate whether oligomerization states differ between experimental systems

  • Resolution Strategies:

    • Design critical experiments specifically targeting the contradictory findings

    • Implement orthogonal methodologies to validate key observations

    • Collaborate with laboratories reporting contradictory results for standardized testing

    • Consider whether apparent contradictions represent different aspects of a complex function

The observed cross-reactivity of BF1176-56 antibody with flaviviruses, despite failure to neutralize ZIKV in some cell types but enhancement of infection in others, provides a concrete example of how apparent contradictions may reflect complex biological mechanisms rather than experimental error . Careful dissection of these nuances through well-designed experiments is essential for advancing understanding of BF1176 function.

What approaches can confirm the biological activity of purified BF1176?

Confirming the biological activity of purified BF1176 requires multiple complementary approaches that assess different aspects of protein functionality:

  • Structural Integrity Assessment:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography to confirm appropriate oligomeric state

    • Dynamic light scattering to assess homogeneity

  • Functional Assays Based on Predicted Functions:

    • Membrane binding assays using liposome flotation

    • Protein-protein interaction studies with identified partners

    • ATPase activity measurements (if predicted by sequence homology)

    • Oligomerization assessment through native PAGE

  • Cell-Based Validation:

    • Complementation of BF1176 knockout bacterial strains

    • Localization studies using fluorescently tagged protein

    • Effects on membrane organization using specialized microscopy techniques

    • Impact on bacterial stress response or growth under various conditions

  • Immunological Activity Assessment:

    • Binding studies with BF1176-56 antibody

    • Evaluation of cross-reactivity with flavivirus epitopes

    • Assessment of potential immunomodulatory effects

For each assay, appropriate positive and negative controls must be included. A properly folded, biologically active BF1176 should demonstrate activity in multiple orthogonal assays, while inactive preparations may show deficiencies across several assays. Statistical analysis should be applied to quantify activity levels and compare them to reference standards .

How can researchers optimize storage conditions to maintain BF1176 stability for long-term studies?

Long-term stability of BF1176 requires careful optimization of storage conditions to maintain structural integrity and biological activity:

Storage ParameterRecommended ApproachScientific Rationale
Buffer CompositionTris/PBS-based buffer, pH 8.0Maintains protein in native conformation
Stabilizing Additives6% TrehaloseActs as a chemical chaperone to prevent denaturation
Glycerol Concentration5-50% (optimally 50%)Prevents ice crystal formation during freezing
Aliquoting StrategySmall volumes (50-100 μL)Minimizes freeze-thaw cycles
Storage Temperature-20°C/-80°CSlows degradation processes
Freeze-Thaw ManagementAvoid repeated cyclesPrevents aggregation and activity loss

Stability monitoring should be implemented through:

  • Regular activity testing of reference aliquots

  • SDS-PAGE analysis to detect degradation products

  • Dynamic light scattering to monitor aggregation state

  • Functional assays specific to BF1176's biological activity

For working stocks, store aliquots at 4°C for up to one week rather than subjecting samples to multiple freeze-thaw cycles. When reconstituting lyophilized protein, brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

For applications requiring exceptional stability, lyophilization with appropriate cryoprotectants should be considered as an alternative to solution storage, particularly for archival samples intended for long-term preservation.

What are the most promising research avenues for understanding BF1176's role in bacterial-viral immunological cross-reactivity?

The unexpected cross-reactivity between BF1176-56 antibody and flaviviruses opens several high-priority research directions:

  • Epitope Mapping and Structural Studies:

    • Determine the precise molecular basis for cross-reactivity through co-crystallization of BF1176-56 with both bacterial and viral targets

    • Identify the minimal epitope required for cross-recognition

    • Engineer modified antibodies with enhanced specificity or cross-reactivity

  • Epidemiological Investigations:

    • Examine whether Bacteroides fragilis colonization status correlates with flavivirus susceptibility or disease outcomes

    • Assess if anti-BF1176 antibody titers predict responses to flavivirus infection or vaccination

    • Investigate geographical correlations between B. fragilis strain prevalence and flavivirus disease patterns

  • Mechanistic Studies of Antibody-Dependent Enhancement:

    • Characterize the mechanistic basis for ZIKV infection enhancement by BF1176-56

    • Determine if similar enhancement occurs with other flaviviruses

    • Investigate cellular receptors and signaling pathways involved in enhancement

  • Translational Applications:

    • Explore whether BF1176-derived peptides could serve as diagnostic tools for distinguishing flavivirus infections

    • Investigate potential for developing broad-spectrum flavivirus vaccines based on conserved epitopes

    • Assess whether modulating gut microbiome composition affects flavivirus immunity

This research area represents a novel intersection between microbiology, virology, and immunology with potential implications for understanding flavivirus pathogenesis and developing new diagnostic and therapeutic approaches .

How can advanced experimental designs improve reproducibility in BF1176 research?

Enhancing reproducibility in BF1176 research requires implementing sophisticated experimental designs that control for various sources of variation:

  • Advanced Blocking Strategies:

    • Implement multi-factor blocking to control for batch effects, researcher variation, and temporal factors

    • Consider Latin Square designs when multiple blocking factors exist

    • Apply split-plot designs when treatments must be applied at different experimental scales

  • Standardization Protocols:

    • Develop reference standards for BF1176 activity assays

    • Establish shared material repositories of validated reagents

    • Create detailed standard operating procedures for key methodologies

  • Robust Statistical Approaches:

    • Conduct a priori power analysis to determine appropriate sample sizes

    • Pre-register experimental protocols and analysis plans

    • Implement blinded analysis workflows

    • Use mixed-effect models to account for random effects

  • Technology Integration:

    • Employ automated liquid handling systems to reduce variability

    • Implement laboratory information management systems for data tracking

    • Utilize electronic laboratory notebooks with standardized templates

  • Collaborative Verification:

    • Establish multi-laboratory validation studies for key findings

    • Create a consortium for standardized BF1176 research methods

    • Implement cross-validation between computational predictions and experimental findings

What are the most critical methodological considerations for successful BF1176 research?

Based on the analysis of current literature and experimental approaches, researchers studying BF1176 should prioritize the following methodological considerations:

  • Expression and Purification Optimization:

    • Careful selection of expression systems with preference for E. coli systems with controlled induction

    • Implementation of optimized purification protocols that maintain protein stability

    • Rigorous quality control to ensure structural integrity and functional activity

  • Experimental Design Rigor:

    • Application of randomized block designs to control for experimental variation

    • Adequate replication to ensure statistical power

    • Inclusion of appropriate positive and negative controls

    • Consideration of Latin Square designs for complex multi-factorial experiments

  • Functional Characterization Approach:

    • Integration of multiple orthogonal techniques to assess biological activity

    • Careful consideration of membrane-associated properties when designing assays

    • Investigation of potential structural homology with viral epitopes

  • Data Analysis and Interpretation:

    • Application of appropriate statistical methods aligned with experimental design

    • Careful consideration of potential confounding factors

    • Integration of results across multiple experimental approaches

By addressing these critical methodological considerations, researchers will be better positioned to generate reliable, reproducible data on BF1176, advancing understanding of its biological functions and potential applications in both microbiology and immunology research .

How should researchers prioritize future investigations of BF1176?

Based on current knowledge and research gaps, the following prioritized research agenda for BF1176 is recommended:

  • High Priority (Immediate Focus):

    • Comprehensive structural determination through integrated structural biology approaches

    • Definitive functional characterization in Bacteroides fragilis using genetic approaches

    • Further investigation of immunological cross-reactivity with flaviviruses

    • Development of standardized reagents and protocols for the research community

  • Medium Priority (Secondary Focus):

    • Interactome mapping to identify protein partners in bacterial cells

    • Comparative analysis across different Bacteroides species

    • Investigation of potential roles in bacterial membrane organization

    • Development of monoclonal antibodies for specific detection and localization

  • Exploratory Directions (Long-term Vision):

    • Potential biotechnological applications based on structural properties

    • Investigation of BF1176 as a potential vaccine component or diagnostic tool

    • Computational modeling of evolutionary relationships with viral proteins

    • Examination of potential roles in host-microbiome interactions

This prioritization framework balances fundamental characterization needs with exploration of novel applications and biological insights. By following this strategic approach, the research community can efficiently advance understanding of BF1176 while maximizing the impact of resource investments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.