Recombinant Bacteroides thetaiotaomicron Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Structure and Function

MscL proteins are relatively simple in structure, typically composed of a small number of transmembrane helices that form a barrel-like structure in the cell membrane . When the membrane experiences increased tension, the channel undergoes a conformational change, opening a pore that allows ions and small molecules to pass through . This activity is crucial for maintaining osmotic balance and preventing cell rupture under hypoosmotic conditions .

Role in Bacteroides thetaiotaomicron Physiology

In B. thetaiotaomicron, MscL likely plays a similar role in maintaining cell integrity under changing environmental conditions . The gut environment can be highly variable in terms of osmolarity and mechanical stress, and MscL would enable B. thetaiotaomicron to rapidly respond to these changes . Furthermore, B. thetaiotaomicron has been shown to impact host immunity and gut microbiota composition, suggesting MscL may indirectly contribute to these broader effects .

Recombinant Production and Research Applications

The production of recombinant B. thetaiotaomicron MscL allows researchers to conduct detailed studies on the protein's structure, function, and regulation . Recombinant protein can be expressed in various host organisms, purified, and then subjected to biophysical and biochemical analyses . Some applications include:

  • Structural studies: X-ray crystallography and cryo-electron microscopy can be used to determine the high-resolution structure of MscL, providing insights into the mechanism of channel gating .

  • Functional assays: Patch-clamp electrophysiology and liposome swelling assays can be employed to measure the channel's response to mechanical stimuli and determine its conductance properties .

  • Drug discovery: MscL has been identified as a potential target for antibacterial compounds . Recombinant MscL can be used in high-throughput screens to identify compounds that modulate channel activity.

MscL as a Drug Target

The discovery that certain compounds can activate MscL, leading to membrane permeabilization and cell death, has opened up new avenues for antibacterial drug development . For example, the antibiotic compound SCH-79797 and its derivative IRS-16 have been shown to directly activate MscL, contributing to their antibacterial activity . This suggests that targeting MscL could be a promising strategy for developing novel antibiotics with increased bacterial specificity and lower rates of acquired resistance .

Impact on Allergic Airway Disease

B. thetaiotaomicron has demonstrated potential in alleviating allergic airway inflammation in murine models . Oral administration of B. thetaiotaomicron can reduce airway hyperresponsiveness and inflammation by modulating T helper cell responses and promoting the expansion of regulatory T cells . While the precise role of MscL in this process is not yet fully understood, it is plausible that MscL-mediated changes in bacterial physiology could indirectly influence the bacterium's immunomodulatory effects .

Role in Gut Microbiota and SCFA Production

B. thetaiotaomicron's metabolic activities, including the production of short-chain fatty acids (SCFAs) like acetate, are linked to its influence on gut health . Research indicates that B. thetaiotaomicron enhances oxidative stress tolerance through rhamnose consumption, leading to increased acetic acid production . These SCFAs play a crucial role in maintaining gut homeostasis and influencing host immunity . The MscL channel might indirectly affect these metabolic processes by regulating the transport of essential nutrients and metabolites across the bacterial membrane .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior communication and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
mscL; BT_4264; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Target Names
mscL
Target Protein Sequence
MGKSTFLQDFKAFAMKGNVIDMAVGVVIGGAFGKIVSSLVANVIMPPIGLLVGGVNFTDL KWVMKAAEVGADGKEIAPAVSLDYGQFLQATFDFLIIAFAIFLFIRLITKLTTKKAAEEA PAAPPAPPAPTKEEVLLTEIRDLLKEKK
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.
Database Links

KEGG: bth:BT_4264

STRING: 226186.BT_4264

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.