Recombinant Bacteroides thetaiotaomicron Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Characterization of Recombinant Bacteroides thetaiotaomicron YidC

Recombinant YidC from Bacteroides thetaiotaomicron is produced in yeast systems, purified to >85% homogeneity, and stored at -20°C/-80°C . Key attributes include:

ParameterDetails
Product CodeCSB-YP805825BDU1
Uniprot IDQ8AA76
Source OrganismBacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079)
Purity>85% (SDS-PAGE)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability
StorageLiquid form: 6 months at -20°C/-80°C; Lyophilized: 12 months at -20°C/-80°C

This recombinant protein retains functional activity, enabling experimental studies on membrane protein insertion mechanisms .

Research Applications and Findings

Recombinant Bacteroides thetaiotaomicron YidC is used to study membrane protein biogenesis. For example:

  • Proteoliposome Reconstitution: YidC is incorporated into lipid vesicles to test substrate insertion efficiency. Mutations in TM3/TM5 (e.g., YidC-5S) impair ATP synthase subunit insertion but retain activity for Sec-independent substrates like M13 procoat .

  • Structural Insights: Cryo-EM and crystallography reveal YidC’s interaction with ribosomes at the translation exit site, positioning substrates for membrane integration .

Mechanistic Model

StageProcessYidC Role
Substrate RecognitionBinding of nascent hydrophobic segmentsHydrophobic groove captures TM segments
Membrane InsertionLateral release into lipid bilayerSliding of TM segments via YidC’s amphiphilic interface
Chaperone ActivityCoordination with SecYEG during co-translational insertionStabilizes SecYEG-substrate complexes

Comparative Analysis with Other YidC Homologs

While Bacteroides thetaiotaomicron YidC shares core functions with homologs like E. coli and Bacillus halodurans YidC, species-specific adaptations exist:

OrganismUnique FeatureReference
Bacteroides thetaiotaomicronOptimized for gut microbiome environments; partial sequence available
E. coliFull-length crystal structure reveals SecY interaction sites
Thermotoga maritimaTM1 helix angle (~15°) critical for Sec translocon interaction

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Kindly consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; BT_0589; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-618
Protein Length
full length protein
Species
Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Target Names
yidC
Target Protein Sequence
MDKNTITGLVLIGILLVGFSYLSRPSEEQIAAQKKYYDSIAVVQQQQEALKAKTEAALAN ENKGAAAAADSSALFFNAMHGTDSKVSIQNSVAEITFTTKGGRVYSAMLKEYKGQDKTNP VVLFDGDDATMSFNFYNKQGAIQTKDYYFEAVNKTDSSVTMRLAADNASYIDFIYTLKPN SYLMNFEIKATGMEGKLASTEYVDIDWTQRARQLEKGFTYENRLSELTYKVKGDNVDNLS AAKDDEKDLGNTAIDWVAFKNQFFSSVFIADQDFNKVSVKSRMEQQGSGYIKDYSAEMST FFDPSGKQPTEMYFYFGPNHFKTLKALDKGRTEKWELNRLVYLGWPLIRWINQFITINVF DWLSGWGLSMGIVLLILTIMVKVVVYPATWKTYMSSAKMRVLKPKIDEINKKYPKQEDAM KKQQEVMSLYSQYGVSPMGGCLPMLLQFPILMALFMFVPSAIELRQQSFLWADDLSTYDA FITFPFHIPFLGNHLSLFCLLMTVTNILNTKYTMTMQDTGAQPQMAAMKWMMYLMPIMFL FVLNDYPSGLNYYYFVSTLISVGTMILLRKTTDETKLLAILEAKKKDPKQMKKTGFAARL EAMQKQQEQLQQQKQNKR
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links

KEGG: bth:BT_0589

STRING: 226186.BT_0589

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in bacterial systems?

YidC is a universally conserved membrane protein insertase that mediates the integration of membrane proteins into the cytoplasmic membrane of bacteria. It functions either independently as a membrane protein insertase or in coordination with the SecY complex during co-translational membrane protein insertion . This protein plays an essential role in facilitating proper membrane protein folding and insertion, helping cells avoid toxic protein aggregation that would result from improperly inserted membrane proteins .

The insertase catalyzes the thermodynamically unfavorable process of translocating hydrophilic polypeptide residues through the hydrophobic core of the membrane, a critical function since spontaneous insertion is limited to highly hydrophobic transmembrane segments .

How is the structure of YidC organized?

The structural model of YidC reveals a distinctive arrangement of five conserved transmembrane domains with a helical hairpin between transmembrane segment 2 (TM2) and TM3 positioned on the cytoplasmic membrane surface . This model was developed using multiple complementary approaches:

  • Evolutionary co-variation analysis

  • Lipid-versus-protein-exposure studies

  • Molecular dynamics simulations

  • Validation against crystal structures

The structural arrangement shows remarkable stability during molecular dynamics simulations, with the five TM helices forming a rigid protein core while the polar loop regions display greater mobility at the membrane surface . The core structure is stabilized through specific interactions: the cytoplasmic side features primarily polar or charged residues engaged in electrostatic interactions, while the periplasmic side contains predominantly aromatic residues involved in stacking and nonpolar dispersion interactions .

How evolutionarily conserved is YidC across different domains of life?

YidC represents a highly conserved family of membrane protein insertases present across all domains of life. The bacterial YidC shares homology with:

  • Alb3 in chloroplasts

  • Oxa1 in mitochondria

This remarkable conservation underscores the fundamental importance of YidC-mediated membrane protein insertion mechanisms in biological systems. The existence of homologous proteins across evolutionarily distant organisms suggests that the basic mechanism of membrane protein insertion has been preserved throughout evolution .

What are the kinetics and mechanism of YidC-mediated membrane protein insertion?

Single-molecule studies have revealed the precise kinetics of YidC-mediated membrane protein insertion using the model substrate Pf3 . The process follows a well-defined temporal sequence:

  • Within 2 milliseconds: The cytoplasmic α-helical hairpin of YidC binds the polypeptide of Pf3 with high conformational variability and kinetic stability

  • Within 52 milliseconds: YidC strengthens its binding to the substrate and employs both the cytoplasmic α-helical hairpin domain and hydrophilic groove to transfer Pf3 to the membrane-inserted, folded state

  • Final inserted state: Pf3 displays low conformational variability typical of transmembrane α-helical proteins

This temporal sequence provides crucial insights into how YidC catalyzes membrane protein insertion, revealing that the process occurs on a millisecond timescale and involves distinct conformational transitions.

What critical residues are essential for YidC function?

Mutagenesis studies coupled with in vivo complementation assays have identified key residues critical for YidC function. Particularly important are:

  • T362 in TM2 and Y517 in TM6: When mutated to alanine, these residues completely inactivate YidC despite being stably expressed, indicating their functional rather than structural importance

  • F433, M471, and F505: Residues in proximity to the T362/Y517 pair that show intermediate activity levels when mutated

  • Residues located further from this critical pair show minimal effects when mutated

These findings suggest that specific residues within the transmembrane domain, particularly those at the same membrane height, play crucial roles in the insertase function of YidC. The stable expression of inactive mutants confirms that the loss of function is not due to protein instability but to disruption of specific functional interactions.

How does YibN interact with YidC and affect membrane protein biogenesis?

YibN has been identified as a bona fide interactor of YidC with significant implications for membrane processes . The interaction between these proteins was established using biotin ligase proximity labeling (BioID) experiments, where YidC was fused to mutant biotin ligase BirA* .

The presence of YibN significantly enhances the biogenesis of multiple YidC substrates:

YidC SubstrateEffect of YibN Co-expression
M13 procoat-Lep fusionSignificantly increased synthesis
Pf3 coat-Lep fusionSignificantly increased synthesis
F1-F0 subunit F0cSignificantly increased synthesis
SecGEffect not specified
YajC (single-pass)Not affected by YidC depletion
YhcB (single-pass)Not affected by YidC depletion

Notably, YibN production is associated with dramatic changes in membrane architecture, including membrane proliferation, circumvolutions, and multilayered structures primarily at the bacterial inner membrane, while the outer membrane remains relatively unaffected . These findings suggest that YibN may act as a cofactor that enhances YidC's insertase activity for specific substrates.

How do molecular dynamics simulations enhance our understanding of YidC function?

Molecular dynamics simulations have provided crucial insights into the stability and functional properties of YidC in the bacterial membrane environment . These simulations reveal:

The excellent agreement between simulation predictions and experimental findings validates this computational approach for studying membrane protein dynamics. Molecular dynamics simulations have successfully identified functionally critical residues that were subsequently confirmed through mutagenesis and complementation assays .

What is the relationship between YidC and the ribosome during co-translational membrane protein insertion?

Cryo-electron microscopy reconstruction of a translating YidC-ribosome complex carrying the YidC substrate F0c reveals key insights into co-translational membrane protein insertion . The structural data demonstrates that:

  • A single copy of YidC interacts directly with the ribosome at the ribosomal tunnel exit

  • This interaction positions the nascent membrane protein at a specific site for insertion

  • The insertion site is located at the YidC protein-lipid interface

This structural arrangement suggests a mechanism where the ribosome-bound YidC captures the nascent membrane protein as it emerges from the ribosomal exit tunnel and facilitates its direct insertion into the lipid bilayer through the YidC protein-lipid interface. This co-translational mode of insertion likely enhances efficiency and prevents misfolding or aggregation of newly synthesized membrane proteins.

What experimental techniques are most effective for studying YidC-mediated membrane protein insertion?

Multiple complementary techniques have proven valuable for investigating YidC function:

  • Structural analysis approaches:

    • Evolutionary co-variation analysis for predicting structural contacts

    • Lipid-versus-protein-exposure studies to map membrane topology

    • X-ray crystallography (as demonstrated with Bacillus halodurans YidC2)

  • Functional assessment methods:

    • In vivo complementation assays to evaluate the impact of mutations

    • Single-molecule force spectroscopy to examine protein-protein interactions

    • Fluorescence spectroscopy to monitor conformational changes

  • Computational methods:

    • Molecular dynamics simulations to study stability and interactions

    • Prediction of protein-lipid interfaces

  • Protein-protein interaction identification:

    • BioID proximity-dependent labeling with mutant biotin ligase BirA*

    • Stable isotope labeling with amino acids in cell culture (SILAC)

    • Liquid chromatography with tandem mass spectrometry (LC-MS/MS)

These diverse methodologies provide complementary insights into different aspects of YidC structure and function, from atomic-level interactions to system-wide effects on membrane protein biogenesis.

How can researchers identify and validate new YidC substrates?

The identification and validation of YidC substrates can be approached through several complementary strategies:

  • Proximity-based labeling approaches:

    • BioID using YidC-BirA* fusion proteins to identify proteins in close proximity to YidC during membrane insertion

    • Analysis of biotinylated proteins using methods such as LC-MS/MS

  • Comparative expression analysis:

    • Co-expression studies comparing membrane protein synthesis with or without YidC

    • Analysis of membrane protein synthesis rates in YidC-depleted conditions

  • In vitro reconstitution:

    • Reconstitution of purified YidC with candidate substrates

    • Assessment of insertion efficiency using protease protection assays or fluorescence-based approaches

  • Functional validation:

    • Assessment of substrate biogenesis using pulse-chase experiments

    • Monitoring growth rates and cell protein content in co-expression experiments

    • Western blot analysis with appropriate detection antibodies

The combination of these approaches allows for robust identification and validation of YidC substrates, providing insights into the substrate specificity of this insertase.

What expression systems are optimal for producing recombinant Bacteroides thetaiotaomicron YidC?

The recombinant Bacteroides thetaiotaomicron membrane protein insertase YidC can be successfully expressed using an in vitro E. coli expression system . While specific optimization parameters are not detailed in the available literature, several considerations are likely important:

  • Selection of appropriate expression vectors (e.g., pBAD22 has been used for YidC expression)

  • Careful control of induction conditions to prevent toxicity

  • Proper membrane extraction techniques using detergents such as DDM (1% concentration has been reported)

  • Purification strategies compatible with membrane proteins

The complete amino acid sequence of Bacteroides thetaiotaomicron YidC is available (UniProt: Q8AA76), facilitating the design of expression constructs . The recombinant protein can be stored at -20°C for standard storage or at -80°C for extended preservation .

How can single-molecule techniques advance our understanding of YidC function?

Single-molecule approaches offer unique insights into YidC-mediated membrane protein insertion that are not accessible through bulk measurements:

  • Single-molecule force spectroscopy:

    • Directly measures the forces involved in YidC-substrate interactions

    • Can detect transient intermediates in the insertion pathway

    • Provides information about the energy landscape of insertion

  • Single-molecule fluorescence spectroscopy:

    • Monitors conformational changes during substrate binding and insertion

    • Can track the real-time dynamics of the insertion process

    • Reveals heterogeneity in molecular behavior that might be masked in ensemble measurements

  • Combined approaches:

    • Integration of single-molecule data with molecular dynamics simulations

    • Correlation of structural information with functional observations

    • Development of comprehensive mechanistic models

These approaches have already revealed the precise kinetics of YidC-mediated insertion, showing that initial substrate binding occurs within 2 ms, followed by strengthening of the interaction and membrane insertion within 52 ms . Such temporal resolution is crucial for understanding the mechanistic details of membrane protein biogenesis.

What is the role of the helical hairpin domain in YidC function?

The helical hairpin domain (HPD) positioned between transmembrane segments TM2 and TM3 of YidC displays interesting functional characteristics:

  • In E. coli, the entire HPD domain can be deleted without compromising cell viability, suggesting it is not essential for core YidC function

  • The HPD demonstrates high flexibility, consistent with its elevated crystallographic B-factors in structural analyses

  • Within just 2 milliseconds, the cytoplasmic α-helical hairpin of YidC can bind substrate polypeptides (such as Pf3) with high conformational variability and kinetic stability

  • The HPD, together with the hydrophilic groove of YidC, facilitates the transfer of substrates to their membrane-inserted, folded state within approximately 52 milliseconds

These findings suggest that while the HPD is not absolutely required for YidC function, it plays an important role in substrate recognition and the initial stages of membrane protein insertion. Its flexibility may allow it to accommodate diverse substrate proteins with different structural characteristics.

What implications does YidC research have for understanding membrane protein disorders?

Research on YidC and its homologs has broad implications for understanding membrane protein disorders across biological systems:

  • YidC homologs exist in all domains of life, including humans, suggesting that mechanistic insights from bacterial systems may inform our understanding of eukaryotic membrane protein insertion disorders

  • The fundamental process of membrane protein insertion is critical for cellular function, and defects in this process are associated with numerous diseases

  • Understanding how YidC facilitates the thermodynamically unfavorable process of translocating hydrophilic polypeptide residues through hydrophobic membranes provides insights into a universal cellular challenge

  • The study of bacterial insertases like YidC provides a simpler model system for investigating principles that may apply to more complex eukaryotic membrane protein biogenesis pathways

This research area represents a prime example of how fundamental bacterial studies can inform broader understanding of essential cellular processes and their dysfunction in disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.