Recombinant Bacteroides thetaiotaomicron Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; BT_1195; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Target Names
mtgA
Target Protein Sequence
MHRPLPIKKILRYARNLLIFFFASTILAVIVYRFMPVYVTPLMVIRSVQQLASGDKPTWK HTWVSFDKISPHLPMAVIASEDNRFAEHNGFDFIEIEKAMKENEKRKRKRGASTISQQTA KNVFLWPQSSWVRKGFEVYFTFLIELFWSKERIMEVYLNSIEMGKGIYGAQATAKYKFNT TAAKLSSGQCALIAATLPNPIRFNSAKPSAYLLKRQKQILRLMNLVPKFPPVEKKAVDKK DTRKKKKK
Uniprot No.

Target Background

Function

Recombinant Bacteroides thetaiotaomicron Monofunctional Biosynthetic Peptidoglycan Transglycosylase (mtgA): A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links

KEGG: bth:BT_1195

STRING: 226186.BT_1195

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Bacteroides thetaiotaomicron and why is it significant for peptidoglycan research?

Bacteroides thetaiotaomicron (B. thetaiotaomicron) is a predominant anaerobic commensal bacterium in the human gut microbiota that belongs to the Bacteroidetes phylum. It plays a crucial role in carbohydrate metabolism, breaking down complex poly- and monosaccharides into beneficial short-chain fatty acids (SCFAs) .

B. thetaiotaomicron is particularly valuable for peptidoglycan research because:

  • It serves as an excellent model organism for studying anaerobic bacteria

  • It possesses genetic tractability with established tools for precise genetic engineering

  • It demonstrates metabolic flexibility that allows survival under diverse environmental conditions

  • Its cell wall structure and peptidoglycan synthesis pathways can be studied to understand bacterial adaptation to gut environments

For researchers beginning work with B. thetaiotaomicron, standard cultivation requires anaerobic conditions with brain heart infusion (BHI) medium supplemented with L-cysteine hydrochloride, hemin, and other growth factors as described in multiple protocols .

What is monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) and how does it differ from bifunctional enzymes?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is an enzyme belonging to the glycosyltransferase family 51 (GT51) that specifically catalyzes the polymerization of lipid II precursors to form glycan strands in bacterial peptidoglycan synthesis . Unlike bifunctional peptidoglycan synthases, mtgA:

  • Possesses only glycosyltransferase (GTase) activity without transpeptidase (TPase) activity

  • Produces uncross-linked glycan strands that may require subsequent action by separate transpeptidases

  • Often has a more specialized role in peptidoglycan biosynthesis

The enzyme typically contains approximately 240-250 amino acids, as exemplified by characterized MGTs from various bacterial species . In experimental settings, mtgA activity can be assayed by monitoring the incorporation of radiolabeled substrates such as UDP-N-acetylglucosamine into peptidoglycan .

How is peptidoglycan synthesized in Bacteroides species and what role does mtgA play?

Peptidoglycan synthesis in Bacteroides species follows a similar pathway to other bacteria but with some distinctive features:

General peptidoglycan synthesis process:

  • Cytoplasmic synthesis of UDP-MurNAc-pentapeptide

  • Formation of lipid I and lipid II precursors at the inner membrane

  • Translocation of lipid II across the membrane

  • Polymerization of lipid II to form glycan strands (catalyzed by GTases like mtgA)

  • Cross-linking of adjacent peptide stems (catalyzed by TPases)

In this process, mtgA specifically catalyzes step 4, creating the glycan backbone of peptidoglycan by forming β-1,4 glycosidic bonds between alternating N-acetylglucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) residues .

The GTase activity can be experimentally measured using several approaches:

  • Monitoring incorporation of radiolabeled precursors into peptidoglycan

  • SDS-PAGE separation of lipid II and newly synthesized glycan strands

  • HPLC analysis of muropeptides after digestion with muramidases

Unlike some other bacterial species, B. thetaiotaomicron exists in an anaerobic gut environment, which may influence peptidoglycan synthesis dynamics, particularly given its demonstrated adaptations to oxidative stress .

What genetic tools are available for creating recombinant B. thetaiotaomicron strains?

Researchers have developed several genetic tools for B. thetaiotaomicron manipulation:

Available genetic tools:

  • Transposon mutagenesis systems for creating barcoded mutant libraries

  • Plasmid vectors compatible with B. thetaiotaomicron

  • CRISPR-Cas systems adapted for Bacteroides

  • Methods for precise genetic engineering and deletion mutant construction

A functional genetics study of B. thetaiotaomicron utilized a barcoded transposon mutant library to identify 516 genes with specific phenotypes under various conditions, including growth on 48 different carbon sources and in the presence of 56 stress-inducing compounds . This approach can be adapted for studying genes involved in peptidoglycan synthesis.

For researchers creating recombinant strains expressing mtgA, it's critical to consider the appropriate translational start site. As observed with S. aureus mgt, multiple in-frame translational start sites may exist, and selecting the correct one is important for producing a functional protein of appropriate length .

What methodological approaches can be used to express and purify recombinant mtgA from B. thetaiotaomicron?

Expression and purification of recombinant mtgA from B. thetaiotaomicron requires specialized approaches:

Expression strategies:

  • Heterologous expression in E. coli:

    • Clone the B. thetaiotaomicron mtgA gene into an expression vector (e.g., pET-16b)

    • Design primers incorporating appropriate restriction sites (e.g., NdeI and BamHI) as demonstrated for S. aureus mgt

    • Consider adding a His-tag for purification

    • Transform into an appropriate E. coli expression strain

  • Homologous expression in B. thetaiotaomicron:

    • Use vectors compatible with B. thetaiotaomicron

    • Consider inducible promoters to control expression levels

    • Incorporate tags that function in the Bacteroides system

Purification protocol outline:

  • Cell lysis under appropriate conditions to maintain enzyme activity

  • Membrane fraction isolation (if mtgA is membrane-associated)

  • Affinity chromatography using tag-based systems

  • Size exclusion chromatography for higher purity

  • Activity validation using in vitro assays

When designing expression constructs, careful consideration of the N-terminal region is essential, as evidenced by studies with S. aureus MGT where selecting the correct translational start site was critical for producing functional enzyme .

How can the enzymatic activity of recombinant B. thetaiotaomicron mtgA be measured in vitro?

Several complementary approaches can be used to assess mtgA enzymatic activity:

Method 1: Radiochemical assay

  • Prepare reaction mixture containing:

    • Membrane fractions (e.g., from A. viridans) or purified recombinant mtgA

    • Radiolabeled UDP-N-acetylglucosamine ([14C] or [3H])

    • UDP-N-acetylmuramylpentapeptide

    • MgCl2 and buffer components

  • Incubate under appropriate conditions (anaerobic for B. thetaiotaomicron enzymes)

  • Stop reaction by adding trichloroacetic acid (TCA)

  • Measure incorporation of radioactivity into TCA-precipitable material

Method 2: SDS-PAGE-based assay

  • React mtgA with lipid II substrate

  • Separate products by SDS-PAGE

  • Visualize glycan strands (if substrate is radiolabeled)

  • Quantify by densitometric analysis

Method 3: HPLC analysis of muropeptides

  • React mtgA with lipid II

  • Stop reaction by boiling at mild acidic pH

  • Digest with muramidase (cellosyl or mutanolysin)

  • Reduce with sodium borohydride

  • Analyze by HPLC with radioactivity detection

  • Calculate average glycan strand length and other parameters

These methods have been successfully employed for measuring activities of peptidoglycan synthases from other bacteria and can be adapted for B. thetaiotaomicron mtgA. The choice of method depends on the specific research question and available equipment.

How does oxidative stress impact peptidoglycan synthesis and mtgA function in B. thetaiotaomicron?

B. thetaiotaomicron is a strictly anaerobic bacterium highly susceptible to oxidative environments, yet research has revealed interesting adaptations that may affect peptidoglycan synthesis:

Oxidative stress responses and peptidoglycan implications:

  • When exposed to air, B. thetaiotaomicron growth is completely inhibited, but the bacterium can restore metabolic functions after returning to anaerobic conditions, albeit with extended generation time (3.38 times normal rate)

  • Carbon source significantly affects oxidative stress tolerance:

    • Growth on rhamnose increases resistance to hydrogen peroxide compared to glucose

    • Rhamnose metabolism triggers unique metabolic responses mediated by RhaR regulator

    • The inhibition zone in H2O2 disk diffusion tests was smaller for rhamnose-grown cells (38 mm) compared to glucose-grown cells (45.3 mm)

  • Potential mechanisms affecting peptidoglycan synthesis:

    • Reduced reactive oxygen species (ROS) during rhamnose metabolism

    • Altered expression of enzymes like pyruvate:ferredoxin oxidoreductase (PFOR)

    • Changes in metabolic pathways producing cell wall precursors

Research methodology for investigating oxidative stress effects:

  • Culture B. thetaiotaomicron anaerobically to mid-log phase

  • Transfer to oxygenated media for controlled exposure

  • Return to anaerobic conditions to assess recovery

  • Monitor growth parameters and cell wall integrity

These findings suggest that peptidoglycan synthesis enzymes, including mtgA, may function differently under oxidative stress, and that carbon source choice in culture media may significantly impact experimental outcomes when studying cell wall synthesis.

What is the relationship between genetic recombination and peptidoglycan structure in B. thetaiotaomicron?

Genetic recombination in B. thetaiotaomicron may influence peptidoglycan structure through several mechanisms:

Recombination patterns:

  • B. thetaiotaomicron maintains high recombination rates at synonymous divergences compared to some other Bacteroides species

  • Unlike B. vulgatus and B. finegoldii, B. thetaiotaomicron does not show genetically isolated clades, suggesting fewer genetic incompatibilities

Implications for peptidoglycan research:

  • Horizontal gene transfer may introduce novel peptidoglycan synthesis genes or variants

  • Recombination can alter restriction-modification systems that protect against foreign DNA

  • Genetic exchange might affect capsular polysaccharide synthesis, which interacts with peptidoglycan layer

The absence of genetic isolation between B. thetaiotaomicron strains may facilitate genetic engineering approaches for studying mtgA function, as there appear to be fewer genetic barriers between strains .

For researchers studying recombinant mtgA in B. thetaiotaomicron, these recombination patterns suggest that foreign DNA may be more readily incorporated and maintained in this species compared to other Bacteroides with stronger genetic isolation.

How does the capsular polysaccharide of B. thetaiotaomicron interact with peptidoglycan synthesis?

The capsular polysaccharide (CPS) of B. thetaiotaomicron interacts with peptidoglycan in complex ways that have implications for mtgA function and recombinant strain viability:

CPS-peptidoglycan relationships:

  • Physical interaction: CPS is anchored to the cell surface, likely interacting with the peptidoglycan layer

  • Protective function: CPS provides resistance against environmental stresses that might otherwise affect peptidoglycan integrity

  • Growth dynamics: Acapsular strains show altered growth kinetics that may reflect changes in cell wall synthesis

Experimental findings on CPS importance:

  • Acapsular B. thetaiotaomicron strains show a longer lag phase in the gut lumen and slightly slower net growth rate

  • When competing against wild-type strains or in complex microbiota, acapsular strains have substantially reduced fitness

  • In low-complexity microbiota without strong competitors, acapsular strains show colonization probability similar to wild-type

These findings suggest that recombinant B. thetaiotaomicron strains engineered to express modified mtgA should maintain normal capsule production to ensure competitive fitness, particularly in complex environments.

The table below summarizes the competitive fitness of capsulated vs. acapsular B. thetaiotaomicron in different environments:

EnvironmentAcapsular B. theta FitnessWild-type B. theta FitnessNotes
Single-strain colonizationComparable to wild-typeBaselineNo colonization defect for acapsular strain
Co-colonization with wild-typeSignificantly reducedDominantAcapsular strain rapidly excluded
Complex microbiota (SPF)Significantly reducedDominantSimilar to co-colonization scenario
Low-complexity microbiotaNear wild-type levelsSlightly betterMinimal competition allows acapsular strain to persist

How can in vivo function of mtgA be studied in B. thetaiotaomicron using animal models?

Studying mtgA function in vivo requires sophisticated animal model approaches:

Gnotobiotic mouse model methodology:

  • Generate recombinant B. thetaiotaomicron strains:

    • Wild-type mtgA expression control

    • Modified mtgA variants (overexpression, mutations, deletions)

    • Consider barcoded strains for population tracking

  • Colonization protocols:

    • Mono-colonization: Introduce single strains to germ-free mice

    • Competitive colonization: Introduce multiple strains simultaneously

    • Sequential colonization: Introduce strains at different timepoints

  • Analysis approaches:

    • Track strain abundance using barcode sequencing

    • Monitor growth dynamics in different gut regions

    • Assess impact of dietary changes on mtgA function

    • Evaluate oxidative stress responses in vivo

Critical considerations:

  • Capsular polysaccharide production significantly affects colonization success

  • Carbon source availability in the gut influences metabolic pathways

  • For competitive assays, consider that acapsular strains have colonization disadvantages

A study using barcoded B. thetaiotaomicron strains revealed that population bottlenecks during colonization significantly impact strain establishment, with microbiota complexity inversely related to colonization probability . These approaches can be adapted to study how mtgA variants affect gut colonization and persistence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.