Recombinant Bacteroides thetaiotaomicron NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoA; BT_4067; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Target Names
nuoA
Target Protein Sequence
MNFTFLVVVLLTALAFVGVVIALSRAISPRSYNVQKFEAYECGIPTRGKSWMQFRVGYYL FAILFLMFDVETAFLFPWAVVMHDMGPQGLVSILFFFIILVLGLAYAWRKGALEWK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be a menaquinone. It couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links

KEGG: bth:BT_4067

STRING: 226186.BT_4067

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bacteroides thetaiotaomicron and why is it significant in microbiome research?

Bacteroides thetaiotaomicron is a Gram-negative, obligate anaerobic bacterium that constitutes a prominent member of the human gut microbiota, particularly within the large intestine. Originally described in 1912 as Bacillus thetaiotaomicron, it was reclassified to the genus Bacteroides in 1919. The bacterium belongs to the Bacteroidaceae family within the Bacteroidales order .

B. thetaiotaomicron serves as an invaluable model organism for studying host-microbe interactions due to its extensive metabolic capabilities. Its proteome consists of 4,779 members, with specialized systems for breaking down complex dietary polysaccharides that would otherwise be indigestible by the human host. The bacterium produces enzymes such as glycoside hydrolases and polysaccharide lyases that convert dietary fibers into fermentable substrates, ultimately generating short-chain fatty acids (SCFAs) like acetate and propionate that serve as critical energy sources for colonic cells .

Beyond its metabolic functions, B. thetaiotaomicron has been associated with immune regulation, particularly through the induction of regulatory T cells that help maintain immune tolerance and prevent excessive inflammatory responses in the gut mucosa. This multifaceted role in human physiology makes it an excellent candidate for research on symbiotic relationships, microbial ecology, and gut-host interactions .

What is NADH-quinone oxidoreductase subunit A (nuoA) and its role in bacterial metabolism?

NADH-quinone oxidoreductase subunit A (nuoA) is an integral component of NADH dehydrogenase I (NDH-1), also known as Complex I of the electron transport chain. NuoA specifically forms part of the inner membrane component of this complex and plays a crucial role in energy transduction processes .

Structurally, nuoA contains three predicted transmembrane domains with the C-terminus located in the cytoplasmic region. Conserved charged amino acid residues, particularly Asp79 and Glu81, have been identified through site-specific mutagenesis as functionally significant. These residues likely participate in proton translocation or maintain structural integrity necessary for complex function .

In bacterial metabolism, the NADH dehydrogenase complex facilitates the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane. This process generates the proton motive force required for ATP synthesis. In B. thetaiotaomicron, an anaerobic organism, this complex would be particularly important for maintaining redox balance during fermentative metabolism .

How does recombinant DNA technology apply to studying nuoA in Bacteroides thetaiotaomicron?

Recombinant DNA technology provides essential tools for investigating nuoA function in B. thetaiotaomicron through several methodological approaches:

  • Gene isolation and characterization: Researchers can isolate the nuoA gene from B. thetaiotaomicron genomic DNA using PCR techniques with specific primers designed based on the known sequence. This enables detailed characterization of the gene structure and regulatory elements.

  • Heterologous expression: The nuoA gene can be cloned into expression vectors and introduced into host organisms more amenable to laboratory manipulation than the strictly anaerobic B. thetaiotaomicron. This approach requires careful consideration of codon optimization and expression conditions.

  • Protein purification and functional studies: Recombinantly expressed nuoA, often with affinity tags for purification, allows for biochemical and structural characterization of the protein in isolation or as part of reconstituted complexes.

  • Mutagenesis studies: Site-directed mutagenesis enables systematic investigation of structure-function relationships by creating specific amino acid substitutions and analyzing their effects on protein function .

When working with recombinant nucleic acid molecules involving B. thetaiotaomicron, researchers must adhere to institutional biosafety requirements, including obtaining approval from the Institutional Biosafety Committee (IBC) through submission of a Memorandum of Understanding and Agreement (MUA) .

What expression systems are most effective for producing recombinant B. thetaiotaomicron nuoA?

The choice of expression system for recombinant B. thetaiotaomicron nuoA requires careful consideration of several factors:

Expression Host Selection:

  • E. coli-based systems: While commonly used for bacterial protein expression, these may require optimization when expressing proteins from the anaerobic B. thetaiotaomicron due to differences in codon usage and potential toxicity issues. BL21(DE3) strains or C41/C43 derivatives specifically designed for membrane protein expression may be advantageous for nuoA.

  • Anaerobic expression hosts: For maintaining functional integrity, expression in related Bacteroides species or other anaerobic bacteria might preserve native folding and modifications.

Vector Design Considerations:

  • Inclusion of appropriate affinity tags (His6, Strep-tag II) positioned to avoid interference with transmembrane domains

  • Inducible promoter systems with tunable expression levels to prevent toxicity

  • Signal sequences optimized for membrane protein targeting

Expression Conditions:

  • Temperature modulation (typically 16-25°C for membrane proteins)

  • Controlled induction protocols using appropriate inducer concentrations

  • Supplementation with specific lipids or detergents to facilitate membrane protein folding

When working with recombinant nucleic acid molecules, researchers must comply with institutional biosafety requirements and obtain proper approval through submission of an MUA with the Institutional Biosafety Committee (IBC) .

What methods are recommended for studying conformational changes in nuoA?

Investigating conformational changes in nuoA requires sophisticated methodological approaches:

Crosslinking Studies:
Research has shown that crosslinking between nuoA and nuoJ subunits in intact Complex I is abolished in the presence of NADH, indicating that conformational changes originating in the hydrophilic subunits extend to the membrane domain . Researchers can employ:

  • Chemical crosslinking with homo- or hetero-bifunctional reagents

  • Site-specific crosslinking using genetically incorporated photo-reactive amino acids

  • Mass spectrometry to identify crosslinked residues

Spectroscopic Techniques:

  • Fluorescence resonance energy transfer (FRET) with strategically placed fluorophores

  • Electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling

  • Hydrogen-deuterium exchange mass spectrometry to monitor solvent accessibility changes

Structural Biology Approaches:

  • Cryo-electron microscopy of the intact complex under different substrate conditions

  • X-ray crystallography of the membrane domain in different conformational states

  • NMR spectroscopy for dynamic measurements of specific labeled regions

Computational Approaches:

  • Molecular dynamics simulations to predict conformational changes

  • Quantum mechanical/molecular mechanical (QM/MM) calculations for energy landscapes

  • Normal mode analysis to identify potential conformational transitions

How can site-directed mutagenesis be applied to investigate nuoA function?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in nuoA. Previous research on Complex I has demonstrated the utility of this approach, as seen with the functional characterization of conserved charged amino acid residues in nuoA, particularly Asp79 and Glu81 .

Methodological Framework for nuoA Mutagenesis Studies:

  • Target Selection:

    • Conserved residues identified through multiple sequence alignments

    • Charged residues in transmembrane domains potentially involved in proton translocation

    • Residues implicated in subunit interactions based on structural data

  • Mutagenesis Strategy:

    • Conservative substitutions (e.g., Asp→Glu, Lys→Arg) to probe charge importance

    • Charge neutralization (e.g., Asp→Asn, Lys→Gln) to eliminate ionic interactions

    • Charge reversal (e.g., Asp→Lys) to test electrostatic requirements

    • Alanine scanning to identify essential residues

  • Functional Assays:

    • NADH:quinone oxidoreductase activity measurements

    • Proton pumping efficiency determinations

    • Complex assembly analysis via BN-PAGE or immunoprecipitation

    • Conformational change assessment through crosslinking studies

  • Data Analysis Framework:

    • Correlation of mutation effects with structural position

    • Thermodynamic analysis of stability changes

    • Kinetic modeling of altered enzymatic parameters

For NADH dehydrogenase I (NDH-1), prior research has shown that site-specific mutations can dramatically affect various aspects of complex function, including substrate binding, cofactor interaction, and inter-subunit communication. For example, the E95Q mutation in the NuoF subunit alters NADH binding and inhibition by NAD+, while also changing the midpoint potential of the FMN cofactor .

How does nuoA interact with other subunits in the NADH-quinone oxidoreductase complex?

The interaction of nuoA with other subunits in the NADH-quinone oxidoreductase complex (Complex I) is critical for both structural integrity and functional activity. Based on available research, nuoA forms key interactions within the membrane domain of Complex I:

Primary Interaction Partners:

  • NuoJ: Research has demonstrated direct interaction between nuoA and nuoJ through crosslinking studies. Importantly, this interaction undergoes conformational changes in the presence of NADH, suggesting its role in coupling electron transfer to proton translocation .

  • Other membrane subunits: Crystal structures of the membrane component at higher resolution have enabled better characterization of the interactions between nuoA and other membrane subunits within Complex I .

Conformational Dynamics:
The conformational change observed in crosslinking studies between nuoA and nuoJ in the presence of NADH indicates that structural changes initiated in the hydrophilic domain (where NADH binding occurs) propagate to the membrane domain. This supports the model where long-range conformational changes couple the electron transfer in the hydrophilic domain to proton pumping in the membrane domain .

Functional Implications:
The strategic positioning of nuoA within the membrane component suggests its potential involvement in the proton translocation pathway. The conserved charged residues Asp79 and Glu81 may participate directly in proton transfer or maintain structural conformations necessary for this process .

What is known about the regulatory mechanisms affecting nuoA expression and function?

The regulation of nuoA expression occurs primarily within the context of the entire nuo operon, which encodes all subunits of Complex I. Based on research findings:

Transcriptional Regulation:
Expression of the nuo operon is regulated by multiple environmental factors including:

  • Oxygen availability

  • Presence of alternative electron acceptors (nitrate, fumarate)

  • C4 dicarboxylates concentration

  • Growth phase and nutrient availability

Post-translational Modifications and Functional Regulation:

  • Detergent and phospholipid activation: Purified NDH-1 (Complex I) activity is enhanced by specific detergents and phospholipids, suggesting that the lipid environment plays a crucial role in maintaining optimal conformation of membrane subunits including nuoA .

  • Metal ion requirements: A tightly bound metal, likely Ca²⁺, is required for activity of the complex .

  • Oxidative damage: Complex I is susceptible to damage by reactive compounds such as tellurite, which may affect the functional integrity of membrane components including nuoA .

Metabolic Context:

  • The NAD⁺/NADH ratio influences the rate of oxygen reduction and reactive oxygen species production by Complex I, potentially affecting nuoA function in redox sensing or response .

  • In B. thetaiotaomicron, an anaerobic organism, the regulation of respiratory complexes like NADH-quinone oxidoreductase would be integrated with its primary fermentative metabolism .

What techniques are most effective for analyzing nuoA activity within Complex I?

Analyzing nuoA activity within Complex I requires specialized techniques that address both the membrane-embedded nature of this subunit and its functional context within the larger complex:

Activity Assays:

  • NADH:ubiquinone oxidoreductase activity measurements:

    • Spectrophotometric monitoring of NADH oxidation at 340 nm

    • Artificial electron acceptors (e.g., ferricyanide) for partial reaction measurements

    • Oxygen consumption measurements using oxygen electrodes

  • Proton translocation assays:

    • pH-sensitive fluorescent dyes to monitor proton movement

    • Membrane potential measurements using potential-sensitive probes

    • Reconstitution into liposomes for controlled proton gradient studies

Structural-Functional Analysis:

  • Crosslinking coupled with functional assays:

    • Chemical crosslinking under various substrate conditions

    • Analysis of how crosslinks affect enzymatic activity

    • Identification of conformational states through mass spectrometry

  • Site-directed spin labeling combined with EPR spectroscopy:

    • Introduction of spin labels at specific sites in nuoA

    • Monitoring of local environment changes during catalysis

    • Correlation of conformational changes with activity states

Reconstitution Systems:

  • Proteoliposome reconstitution:

    • Controlled lipid composition to mimic native environment

    • Directional insertion to allow proton gradient measurements

    • Co-reconstitution with other respiratory complexes

  • Nanodiscs or amphipol stabilization:

    • Defined membrane mimetic environment

    • Compatibility with structural and spectroscopic techniques

    • Preservation of conformational flexibility

Contribution Analysis:

  • Subunit deletion or replacement:

    • Complementation of null mutants with modified nuoA variants

    • Hybrid complex assembly with subunits from different organisms

    • Structure-guided chimeric constructs to define functional domains

How do mutations in nuoA affect Complex I assembly and function?

Mutations in nuoA can have profound effects on both the assembly and function of Complex I, as demonstrated by research on various bacterial systems:

Assembly Effects:
Null mutations in individual nuo genes, including nuoA, result in growth defects under aerobic conditions in rich medium, highlighting the essential nature of each subunit for proper complex assembly and function . The specific impacts of nuoA mutations include:

  • Disruption of membrane domain integrity: As nuoA is part of the inner membrane component of Complex I, mutations affecting transmembrane domains can prevent proper integration into the membrane.

  • Impaired inter-subunit interactions: Mutations in regions involved in interactions with other subunits (particularly nuoJ) can disrupt the assembly process or create unstable complexes.

  • Altered complex stoichiometry: Some mutations may allow partial assembly but with aberrant subunit stoichiometry, resulting in functionally compromised complexes.

Functional Consequences:
Research on Complex I has revealed that specific amino acid substitutions can significantly impact various aspects of enzyme function:

  • Proton translocation efficiency: Mutations in conserved charged residues (Asp79, Glu81) may directly affect proton movement through the membrane domain .

  • Conformational dynamics: As evidenced by crosslinking studies, nuoA undergoes conformational changes in the presence of NADH. Mutations that restrict or alter these conformational changes could uncouple electron transfer from proton pumping .

  • Reactive oxygen species (ROS) production: Complex I is known to produce reactive oxygen species, mainly H₂O₂. Mutations affecting the coupling efficiency may increase ROS production, potentially damaging the cell .

What are the challenges in comparing nuoA from B. thetaiotaomicron with homologs from other bacterial species?

Comparing nuoA from B. thetaiotaomicron with homologs from other bacterial species presents several significant challenges that researchers must address:

Evolutionary and Structural Divergence:

  • Sequence conservation patterns: While core functional regions may be conserved, peripheral regions often show significant divergence, complicating alignment and functional prediction.

  • Transmembrane topology differences: Variations in the number and arrangement of transmembrane domains can affect structural comparisons and functional interpretations.

  • Context-dependent functions: NuoA may have evolved species-specific interactions with other complex subunits, reflecting adaptation to different ecological niches.

Metabolic Context Variations:

  • Aerobic vs. anaerobic lifestyle: B. thetaiotaomicron is an obligate anaerobe , while many model organisms used for Complex I studies are facultative or obligate aerobes, potentially resulting in different selective pressures on nuoA function.

  • Alternative electron transport chains: Different bacterial species may have variant electron transport systems that interact with Complex I in distinct ways.

  • Energy conservation strategies: Organisms from different environments may prioritize different aspects of Complex I function (energy conservation efficiency vs. regulatory roles).

Methodological Challenges:

  • Expression and purification differences: Proteins from diverse bacterial sources may require significantly different conditions for optimal expression and purification.

  • Functional assay standardization: Comparing activity measurements across species requires careful standardization of assay conditions to account for different optimal environments.

  • Structural analysis techniques: The membrane-embedded nature of nuoA presents challenges for obtaining high-resolution structural data necessary for detailed comparisons.

Comparative Analysis Framework:
To address these challenges, researchers should implement:

  • Phylogenetic analyses to place functional differences in evolutionary context

  • Homology modeling based on available high-resolution structures

  • Chimeric protein approaches to isolate species-specific functional elements

  • Standardized functional assays adaptable to proteins from different species

How can researchers investigate the role of nuoA in reactive oxygen species (ROS) production?

Investigating the role of nuoA in reactive oxygen species (ROS) production by Complex I requires sophisticated methodological approaches that address both the membrane-embedded nature of this subunit and the complexity of ROS generation mechanisms.

ROS Detection and Quantification:

  • H₂O₂ measurements:

    • Amplex Red assay for extracellular H₂O₂ detection

    • HyPer protein-based sensors for intracellular H₂O₂ monitoring

    • Chemiluminescence techniques for real-time detection

  • Superoxide detection:

    • Lucigenin or coelenterazine-based chemiluminescence

    • Electron paramagnetic resonance (EPR) with spin traps

    • Fluorescent probes (e.g., dihydroethidium derivatives)

Experimental Design Strategies:

  • Site-directed mutagenesis approach:

    • Target conserved residues in nuoA near proposed ROS production sites

    • Analyze how mutations affect ROS production rates

    • Correlate structural changes with altered ROS generation

  • Modulation of electron transfer:

    • Varying NAD⁺/NADH ratios to alter electron flux through Complex I

    • Use of specific inhibitors to block defined steps in electron transfer

    • Measurement of ROS production as a function of membrane potential

  • Reconstitution systems:

    • Purified Complex I components in controlled lipid environments

    • Defined substrate concentrations and electron acceptor availability

    • Isolation from competing cellular antioxidant systems

Research Context from Literature:
Previous research has established that NDH-1 (Complex I) produces reactive oxygen species, primarily in the form of H₂O₂, at the NADH dehydrogenase active site involving the FMN cofactor . The rate of oxygen reduction and subsequent ROS formation is dependent on the NAD⁺/NADH ratio . While these findings focus on the hydrophilic domain where the NADH binding site is located, the membrane domain containing nuoA may influence ROS production through:

What are common challenges in expressing and purifying recombinant B. thetaiotaomicron proteins?

Expressing and purifying recombinant proteins from B. thetaiotaomicron presents several challenges that researchers must address through careful experimental design and optimization:

Expression Challenges:

  • Anaerobic adaptation: As B. thetaiotaomicron is an obligate anaerobe , its proteins may have evolved features that are incompatible with expression in aerobic systems.

  • Codon usage bias: Differences in codon preference between B. thetaiotaomicron and common expression hosts can lead to translational pausing, premature termination, or misfolding.

  • Membrane protein toxicity: Overexpression of membrane proteins like nuoA can disrupt host membrane integrity, leading to growth inhibition or cell death.

  • Post-translational modifications: Any native modifications required for proper folding or function may be absent in heterologous expression systems.

Purification Challenges:

  • Detergent selection: Finding appropriate detergents that efficiently extract membrane proteins while maintaining their structural integrity and functional activity.

  • Protein stability: Maintaining stability of anaerobic proteins during aerobic purification procedures may require oxygen-free environments or stabilizing additives.

  • Protein-lipid interactions: Loss of specific lipid interactions during purification may affect protein conformation and activity.

  • Aggregation propensity: Membrane proteins have hydrophobic surfaces that can promote aggregation during concentration steps.

Strategic Solutions:

  • Expression optimization:

    • Codon optimization for the expression host

    • Use of specialized expression strains (C41/C43, Lemo21)

    • Controlled induction protocols (lower temperature, reduced inducer concentration)

    • Fusion partners to enhance solubility or folding

  • Purification refinement:

    • Screening multiple detergents or amphipathic polymers

    • Addition of lipids during purification

    • Use of stabilizing additives (glycerol, specific ions)

    • Size exclusion chromatography to remove aggregates

  • Activity preservation:

    • Reconstitution into lipid nanodiscs or liposomes

    • Maintenance of anaerobic conditions during critical steps

    • Inclusion of cofactors required for structural integrity

How can researchers maintain anaerobic conditions during functional studies of nuoA?

Maintaining anaerobic conditions is crucial when studying proteins from obligate anaerobes like B. thetaiotaomicron , particularly for functional analyses where exposure to oxygen may alter activity or structural integrity:

Experimental Setup Options:

  • Anaerobic chambers/glove boxes:

    • Complete systems that maintain constant anaerobic atmosphere

    • Allow manipulation of samples without oxygen exposure

    • Can accommodate various equipment for assays and analyses

  • Sealed cuvette systems:

    • Gas-tight spectrophotometric cuvettes with septa for additions

    • Oxygen-scavenging enzyme systems (glucose oxidase/catalase)

    • Oxygen sensors to monitor and verify anaerobic conditions

  • Flow systems:

    • Continuous flow of anaerobic buffer through reaction chambers

    • In-line oxygen sensors for real-time monitoring

    • Specialized mixing devices for rapid kinetic measurements

Chemical Approaches:

  • Reducing agents:

    • Dithionite, dithiothreitol, or β-mercaptoethanol to maintain reduced environment

    • Titanium(III) citrate as a non-interfering reductant

    • Enzymatic systems (glucose/glucose oxidase) for oxygen removal

  • Oxygen indicators:

    • Resazurin for visual confirmation of anaerobic conditions

    • Quantitative oxygen probes for precise measurement

    • Methyl viologen as a redox indicator and oxygen scavenger

Practical Implementation:

  • Buffer preparation:

    • Degassing using vacuum/sonication

    • Sparging with high-purity nitrogen or argon

    • Addition of oxygen scavengers immediately before use

  • Sample handling:

    • Gas-tight syringes for transfers

    • Minimizing headspace in vessels

    • Using positive pressure of inert gas during manipulations

  • Activity measurements:

    • Conducting assays in sealed vessels with oxygen-impermeable materials

    • Implementing rapid-mixing techniques to minimize exposure time

    • Including parallel controls with controlled oxygen exposure to quantify effects

What methodological approaches help overcome protein instability issues with recombinant nuoA?

Membrane proteins like nuoA often present significant stability challenges during expression, purification, and functional characterization. Several methodological approaches can help overcome these issues:

Fusion Partner Strategies:

  • Solubility-enhancing tags:

    • Maltose-binding protein (MBP)

    • NusA or SUMO fusion partners

    • Thioredoxin for disulfide bond formation

  • Stability-enhancing modifications:

    • Thermostabilized GFP or fluorescent protein fusions

    • Designed ankyrin repeat proteins (DARPins) as stabilizing binding partners

    • Removal of flexible regions based on structural predictions

Membrane Mimetic Systems:

  • Detergent optimization:

    • Systematic screening of detergent types and concentrations

    • Mixed detergent systems for improved stability

    • Addition of cholesterol or specific lipids as stabilizers

  • Alternative membrane mimetics:

    • Nanodiscs with defined lipid composition

    • Styrene-maleic acid lipid particles (SMALPs) for native-like environment

    • Amphipols for detergent-free membrane protein stabilization

    • Bicelles for solution NMR applications

Protein Engineering Approaches:

  • Surface engineering:

    • Introduction of surface-exposed mutations to reduce aggregation

    • Elimination of exposed hydrophobic residues

    • Addition of salt bridges to enhance stability

  • Conformational stabilization:

    • Introduction of disulfide bonds to lock conformations

    • Thermostabilizing mutations identified through directed evolution

    • Co-expression with stabilizing binding partners

Practical Implementation Strategies:

  • Storage conditions optimization:

    • Identification of optimal pH and ionic strength

    • Addition of specific ligands or substrates that enhance stability

    • Glycerol or sucrose as cryoprotectants

  • Handling procedures:

    • Minimizing freeze-thaw cycles

    • Temperature control during purification steps

    • Addition of protease inhibitors to prevent degradation

  • Activity preservation:

    • Addition of lipids that promote native-like environment

    • Maintenance of reducing conditions

    • Inclusion of stabilizing ions (particularly divalent cations like Ca²⁺, which has been identified as important for Complex I activity )

How might single-molecule techniques advance our understanding of nuoA function?

Single-molecule techniques offer unprecedented insights into the conformational dynamics and functional mechanisms of membrane proteins like nuoA. These approaches could significantly advance our understanding in several key areas:

Conformational Dynamics:
Single-molecule FRET (smFRET) could reveal the conformational changes in nuoA that occur during the catalytic cycle. This is particularly relevant given the evidence that nuoA undergoes conformational changes in the presence of NADH, as demonstrated by alterations in crosslinking patterns with nuoJ . By strategically placing fluorophores at key positions in nuoA, researchers could:

  • Track real-time conformational changes during substrate binding and catalysis

  • Identify distinct conformational states and transition pathways

  • Correlate conformational changes with functional events in the catalytic cycle

Force Measurements:
Atomic force microscopy (AFM) or optical/magnetic tweezers could provide insights into the mechanical aspects of nuoA function, particularly:

  • Force generation associated with conformational changes

  • Mechanical stability of different protein domains

  • Energy landscapes of conformational transitions

Single-Molecule Electrophysiology:
Given nuoA's role in the membrane domain of Complex I, which is involved in proton translocation, single-channel recordings could:

  • Directly measure proton conductance associated with Complex I activity

  • Characterize the gating properties of proton translocation pathways

  • Assess how mutations in nuoA affect proton movement at the single-molecule level

Implementation Challenges and Solutions:

  • Protein labeling strategies:

    • Site-specific incorporation of unnatural amino acids for bioorthogonal chemistry

    • Split-inteins for protein trans-splicing with pre-labeled peptides

    • Enzymatic labeling approaches using sortase or sfp phosphopantetheinyl transferase

  • Membrane protein immobilization:

    • Supported lipid bilayers with controlled orientation

    • DNA origami platforms for precise spatial arrangement

    • Nanodiscs tethered to surfaces via engineered handles

  • Signal detection in complex environments:

    • Total internal reflection fluorescence (TIRF) microscopy for improved signal-to-noise

    • Zero-mode waveguides for measurements at physiological concentrations

    • Alternating laser excitation (ALEX) for improved FRET analysis

What computational approaches could enhance prediction of nuoA structure-function relationships?

Advanced computational approaches offer powerful tools for predicting and understanding nuoA structure-function relationships, complementing experimental techniques:

Artificial Intelligence-Based Structure Prediction:
Recent breakthroughs in protein structure prediction using AI approaches like AlphaFold2 and RoseTTAFold could:

  • Generate high-confidence structural models of nuoA in isolation

  • Predict interactions with other Complex I subunits

  • Model conformational states not captured by experimental structures

Molecular Dynamics Simulations:
All-atom molecular dynamics simulations in explicit membrane environments could provide insights into:

  • Dynamic behavior of nuoA within lipid bilayers

  • Conformational changes associated with proton translocation

  • Water dynamics in putative proton channels

  • Effects of mutations on structural stability and dynamics

Quantum Mechanical/Molecular Mechanical (QM/MM) Calculations:
For more accurate modeling of electron and proton transfer processes:

  • Electronic structure calculations of conserved residues involved in proton transfer

  • Energy profiles for proton movement through channels

  • Coupling between electron transfer and proton translocation events

Coevolutionary Analysis:
Statistical analysis of sequence covariation across large numbers of homologs can reveal:

  • Functionally coupled residues that may be distant in primary sequence

  • Interaction networks within and between subunits

  • Evolutionary constraints on sequence variation in functional regions

Network Analysis and Machine Learning:
Integration of multiple data types through machine learning approaches:

  • Prediction of functional effects of mutations

  • Identification of allosteric communication pathways

  • Classification of structural motifs associated with specific functions

Implementation Challenges and Solutions:

  • Computational resource requirements:

    • Utilization of GPU acceleration for molecular dynamics

    • Distributed computing approaches for large-scale simulations

    • Cloud computing resources for AI-based predictions

  • Force field limitations:

    • Development and validation of specialized force fields for membrane proteins

    • Polarizable force fields for more accurate electrostatic interactions

    • Integration of experimental constraints to guide simulations

  • Integration with experimental data:

    • Bayesian frameworks for combining computational and experimental information

    • Iterative refinement of models based on new experimental insights

    • Development of testable predictions to guide experimental design

How might studies of nuoA contribute to understanding Complex I dysfunction in human diseases?

While nuoA from B. thetaiotaomicron is a bacterial protein, studies of its function and structure-function relationships can provide valuable insights relevant to human Complex I-related diseases through comparative analysis and evolutionary principles:

Conserved Mechanisms and Structures:
Despite evolutionary divergence, fundamental mechanisms of Complex I function are conserved across bacteria and eukaryotes. Research on bacterial nuoA can illuminate:

  • Core functional principles of proton translocation

  • Essential structural elements required for complex assembly

  • Conserved residues whose mutation might lead to dysfunction

Model System Advantages:
Bacterial systems offer several advantages for investigating disease-relevant mechanisms:

  • Simplified genetic manipulation compared to mammalian cells

  • Ability to express and purify proteins in larger quantities

  • Faster generation time for evolutionary and mutational studies

  • Reduced complexity while maintaining core functional elements

Translational Research Pathways:
Findings from bacterial nuoA studies could contribute to understanding human disease through:

  • Identification of critical residues:

    • Mapping of bacterial mutations to homologous positions in human Complex I

    • Prediction of pathogenicity for novel variants identified in patients

    • Understanding the molecular basis of known pathogenic mutations

  • Drug development strategies:

    • Identification of allosteric sites that could be targeted therapeutically

    • Screening platforms using bacterial Complex I for initial drug discovery

    • Structure-based design of molecules that modulate Complex I activity

  • Bioenergetic dysfunction mechanisms:

    • Insights into how structural perturbations affect energy transduction

    • Understanding ROS production mechanisms that contribute to oxidative stress

    • Elucidation of assembly pathways relevant to disease-causing assembly defects

Methodological Approaches:

  • Comparative genomics:

    • Systematic comparison of bacterial and human Complex I subunits

    • Identification of conserved sequence motifs and structural elements

    • Evolutionary analysis to trace functional adaptations

  • Chimeric proteins:

    • Construction of hybrid proteins containing human domains in bacterial context

    • Functional complementation studies with human disease variants

    • Analysis of species-specific functional differences

  • Disease-mimicking mutations:

    • Introduction of mutations in bacterial nuoA that correspond to human disease variants

    • Functional characterization using bacterial systems

    • Correlation of biochemical defects with clinical phenotypes

Comparative Analysis of nuoA Structural Features Across Species

OrganismTransmembrane DomainsProtein Length (aa)Key Functional ResiduesNotable Structural Features
B. thetaiotaomicron3 predicted~120-140*Asp79, Glu81 (predicted based on homology)C-terminus located in cytoplasm
E. coli3 confirmed147Asp79, Glu81C-terminus in cytoplasm, crosslinks with NuoJ
T. thermophilus3 confirmed139Asp63, Glu65 (homologous to D79, E81)Higher thermostability, crystal structure available
Human (NDUFA1)1 predicted70Different architecture from bacterial homologsAssociated with X-linked Complex I deficiency

*Exact length based on prediction from homology; may require experimental verification
Note: Data compiled based on available research on Complex I structure across species

Expression SystemYield PotentialMembrane IntegrationNative FoldingTechnical ComplexityBest Applications
E. coli BL21(DE3)MediumVariableModerateLowInitial screening, mutagenesis
E. coli C41/C43Medium-HighGoodModerateLowToxic membrane proteins
E. coli Lemo21MediumGoodModerateMediumTunable expression level
Bacteroides speciesLow-MediumExcellentExcellentHighNative-like environment
Cell-free systemsLow-MediumRequires lipids/detergentsVariableHighDifficult-to-express variants
Mammalian cellsLowGoodGood (for eukaryotic homologs)HighComplex functional studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.