Recombinant Bacteroides thetaiotaomicron Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; BT_2423; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Target Names
kdpC
Target Protein Sequence
MKTLFKSLKITLVFCVFFSVFYILILWLFAQVAGPNKGNAEVATLDGKVVGAANVGQMFT KDIYFWGRPSCAGDGYDASSSSGSNKGPTNPEYLAEVEARIDTFLVHHPYLSRKDVPAEM VTASASGLDPNITPQCAYVQVKRVAQARGLTENQVKEIVDQSVEKPLLGIFGTEKINVLK LNIALEENK
Uniprot No.

Target Background

Function
This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit, KdpB, through the formation of a transient KdpB/KdpC/ATP ternary complex.
Database Links

KEGG: bth:BT_2423

STRING: 226186.BT_2423

Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What growth conditions are optimal for Bacteroides thetaiotaomicron prior to kdpC expression studies?

Bacteroides thetaiotaomicron is a strictly anaerobic bacterium that requires specialized growth conditions. For optimal growth prior to kdpC expression studies, researchers should culture the organism in anaerobic conditions using Brain Heart Infusion (BHI) medium to the mid-logarithmic phase (OD600 = 0.6-0.8). Standard growth in BHI under anaerobic conditions yields an average generation time of approximately 3.5 hours . When transitioning to defined media, deoxygenated Defined Medium (DM) supplemented with glucose (DMG) or other carbon sources can be used, with an initial OD600 of approximately 0.01-0.02. Cultures should be maintained at 37°C in an anaerobic chamber.

It's important to note that B. thetaiotaomicron is highly susceptible to oxidative environments, and exposure to air completely inhibits growth . When designing experiments involving kdpC expression, maintain strict anaerobic conditions during all culturing steps to ensure optimal cell density and protein expression.

How does carbon source selection affect protein expression in B. thetaiotaomicron?

The carbon source significantly impacts metabolism and potentially protein expression in B. thetaiotaomicron. Research has demonstrated distinct metabolic profiles when the bacterium utilizes different carbon sources:

Carbon SourcePrimary MetabolitesOxidative Stress ToleranceGeneration Time
Glucose (DMG)Acetate, succinate, lactateLowerStandard (baseline)
Rhamnose (DMR)Acetate (4× higher than glucose), 1,2-propanediolHigherVariable

When cultured with rhamnose as the sole carbon source, B. thetaiotaomicron produces approximately 4 times more acetic acid compared to growth with glucose after 6 days . Additionally, bacteria grown on rhamnose demonstrate greater resilience to oxidative stress, with hydrogen peroxide inhibition zones measuring approximately 38 mm in diameter versus 45.3 mm for glucose-grown cultures .

For kdpC expression studies, consider that carbon source may affect not only growth rates but also stress responses and potentially recombinant protein yields. The enhanced oxidative stress tolerance observed with rhamnose might be beneficial for downstream processing steps that involve exposure to oxygen.

What Design of Experiments (DoE) approach is most effective for optimizing recombinant kdpC expression in B. thetaiotaomicron?

Rather than using the inefficient one-factor-at-a-time approach that fails to account for factor interactions, researchers should employ a systematic DoE strategy for optimizing recombinant kdpC expression in B. thetaiotaomicron . Response Surface Methodology (RSM) is particularly effective for optimizing recombinant protein expression as it can help identify optimal conditions while minimizing experimental runs.

A typical DoE approach for kdpC expression would involve:

  • Factor identification: Key factors affecting expression typically include induction timing, inducer concentration, temperature, media composition, and oxygen levels.

  • Screening design: Use fractional factorial designs to identify significant factors from the initial larger set.

  • Optimization design: Apply Central Composite Design (CCD) or Box-Behnken Design to model response surfaces for the significant factors.

This approach allows researchers to predict the effect of each factor and their interactions on kdpC expression with a carefully selected small set of experiments, reducing cost and time while improving outcomes . Several software packages (such as JMP, Design-Expert, or Minitab) can facilitate DoE implementation and results analysis.

How can I design an efficient vector for recombinant kdpC expression in B. thetaiotaomicron?

When designing an expression vector for kdpC in B. thetaiotaomicron, consider the following methodological approach:

  • Promoter selection: For efficient expression, select promoters known to function well in B. thetaiotaomicron. Research indicates that the promoter region used in the pNLY1-PsusA vector system has been successfully employed for gene expression in this organism . Similarly, the research on BT_3768 (rhaR) gene utilized a 450 bp upstream sequence as a promoter, which could be assessed for your kdpC expression .

  • Vector backbone: Use vectors that have been demonstrated to replicate in B. thetaiotaomicron, such as those derived from the pNLY1-PsusA system.

  • Selection markers: Include appropriate antibiotic resistance markers for selection in both E. coli (for cloning) and B. thetaiotaomicron. Gentamicin and chloramphenicol resistance have been used successfully for selection of transformed B. thetaiotaomicron .

  • Conjugation strategy: For introducing the vector into B. thetaiotaomicron, a conjugation approach using E. coli S17-1 as a donor strain has proven effective . The plasmid is first transformed into E. coli DH5α using the CaCl₂ method, verified, and then transferred to E. coli S17-1 before conjugation with B. thetaiotaomicron.

  • Codon optimization: Consider codon usage bias in B. thetaiotaomicron when designing your kdpC gene insert to improve translation efficiency.

How does oxidative stress affect kdpC function in B. thetaiotaomicron, and what methodologies can assess this relationship?

As a strictly anaerobic bacterium, B. thetaiotaomicron is highly susceptible to oxidative environments. Research has shown that exposure to air completely inhibits growth, though the bacterium can slowly restore metabolic functions when returned to anaerobic conditions . To investigate the relationship between oxidative stress and kdpC function, consider the following methodological approach:

  • Controlled oxidative exposure: Culture B. thetaiotaomicron with recombinant kdpC expression in anaerobic conditions until mid-log phase. Then expose the culture to controlled levels of oxidative stress using either:

    • Atmospheric oxygen exposure (as described in the research protocol where cells were resuspended in oxygenated medium and shaken at 37°C for specific time periods)

    • Hydrogen peroxide gradient analysis using the agar diffusion method (where sterile disks with H₂O₂ create a concentration gradient on agar plates)

  • Transcriptional analysis: Assess kdpC gene expression changes under oxidative stress using RT-qPCR. Extract RNA from samples before and after oxidative exposure, synthesize cDNA, and perform RT-qPCR using 16S rRNA as a control gene . Analyze results using the 2^(-ΔΔCT) method based on triplicate experiments.

  • Viability assessment: Determine how oxidative stress affects cellular viability in connection to kdpC function by diluting bacterial suspensions post-exposure, plating on appropriate media, and counting colonies after anaerobic incubation .

  • Protein activity assays: Develop specific assays to measure kdpC activity (as part of the Kdp-ATPase complex) before and after oxidative stress to correlate functional changes with stress levels.

This comprehensive approach can provide insights into how oxidative stress impacts kdpC function and whether this protein plays a role in oxidative stress tolerance mechanisms.

What strategies can be employed to study the interaction between kdpC and carbohydrate metabolism in B. thetaiotaomicron?

To investigate potential interactions between kdpC and carbohydrate metabolism in B. thetaiotaomicron, researchers can implement several sophisticated methodological approaches:

  • Comparative growth studies: Culture B. thetaiotaomicron wild-type and kdpC mutant strains in defined media containing different carbon sources (such as glucose and rhamnose). Monitor growth rates, SCFA production, and metabolic byproducts using gas chromatography as described in previous research . This approach can reveal whether kdpC affects the bacterium's ability to utilize different carbon sources.

  • Transcriptomic analysis: Perform RNA-Seq or targeted RT-qPCR to compare expression profiles of carbohydrate metabolism genes between wild-type and kdpC-modified strains. This can identify regulatory relationships between potassium transport and carbohydrate utilization pathways.

  • Metabolic flux analysis: Employ isotope-labeled carbon sources to trace metabolic pathways and determine if kdpC expression alters carbon flux through central metabolism.

  • Protein-protein interaction studies: Investigate potential physical interactions between kdpC and carbohydrate metabolism proteins using techniques such as co-immunoprecipitation or bacterial two-hybrid systems.

  • Electrophysiology studies: Assess whether different carbohydrate sources affect membrane potential and ion transport activities associated with the Kdp-ATPase complex.

These approaches can provide comprehensive insights into how potassium transport via kdpC may intersect with carbohydrate metabolism in B. thetaiotaomicron, potentially revealing new regulatory mechanisms in this important gut symbiont.

What are the most effective methods for purifying recombinant kdpC from B. thetaiotaomicron?

Purifying recombinant membrane proteins like kdpC presents unique challenges due to their hydrophobic nature and association with the membrane. A comprehensive purification strategy should include:

  • Expression optimization: Before purification, optimize expression conditions using DoE approaches as discussed earlier . Consider including affinity tags (His-tag, FLAG-tag, etc.) to facilitate purification.

  • Cell disruption: For B. thetaiotaomicron, efficient cell disruption can be achieved through:

    • Lysozyme treatment (10 mg/mL) followed by homogenization

    • Sonication in an anaerobic chamber to minimize oxidative damage

    • Mechanical disruption using bead-beating or French press

  • Membrane protein extraction: Since kdpC is a membrane protein component of the Kdp-ATPase complex:

    • Separate membrane fractions by ultracentrifugation

    • Extract membrane proteins using appropriate detergents (DDM, LDAO, or Triton X-100)

    • Optimize detergent concentration through systematic testing

  • Chromatography steps:

    • Affinity chromatography using the engineered tag

    • Ion exchange chromatography, leveraging the charged nature of proteins

    • Size exclusion chromatography as a final polishing step

  • Quality assessment:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Mass spectrometry for protein confirmation

    • Functional assays to verify activity of the purified protein

For optimal results, all purification steps should be performed in the presence of potassium ions and appropriate detergents to maintain protein stability and functionality.

How can I design experimental controls to validate kdpC function in recombinant expression systems?

Designing robust experimental controls is crucial for validating kdpC function in recombinant expression systems. A comprehensive validation approach should include:

  • Genetic controls:

    • Wild-type B. thetaiotaomicron strain (positive control)

    • kdpC knockout mutant (negative control)

    • Complemented kdpC mutant strain (restoration control)

    • Expression of inactive kdpC mutant (functional domain validation)

  • Functional assays:

    • Potassium uptake measurements using radioactive ^86Rb+ as a K+ analog

    • Growth assays under potassium-limiting conditions to assess functional complementation

    • ATPase activity assays to measure the functionality of the Kdp complex

    • Membrane potential measurements to assess ion transport

  • Expression validation:

    • RT-qPCR to verify transcription levels

    • Western blotting to confirm protein expression

    • Immunolocalization to verify proper membrane localization

  • Environmental controls:

    • Testing under varying potassium concentrations

    • Exposure to different carbon sources to assess metabolic interactions

    • Oxidative stress conditions to evaluate stress response relationships

  • Statistical validation:

    • Perform all experiments in triplicate minimum

    • Apply appropriate statistical tests to verify significance of results

    • Use DoE approaches to minimize experimental bias

These controls collectively ensure that the observed effects are specifically attributable to kdpC function rather than experimental artifacts or secondary effects.

What are common issues in expressing recombinant membrane proteins like kdpC in B. thetaiotaomicron, and how can they be addressed?

Expressing recombinant membrane proteins presents several challenges, particularly in anaerobic organisms like B. thetaiotaomicron. Common issues and their solutions include:

  • Poor expression levels:

    • Problem: Membrane proteins often express at lower levels than soluble proteins

    • Solution: Optimize expression using DoE approaches focused on induction conditions, temperature, and media composition

    • Alternative approach: Test different promoter strengths and ribosome binding sites; the promoter region used in the pNLY1-PsusA vector system has shown efficacy

  • Protein misfolding and aggregation:

    • Problem: Membrane proteins may misfold when overexpressed

    • Solution: Lower induction temperature (25-30°C instead of 37°C) and reduce expression rate

    • Alternative approach: Co-express with molecular chaperones to aid proper folding

  • Toxicity to host cells:

    • Problem: Membrane protein overexpression may disrupt membrane integrity

    • Solution: Use tightly regulated inducible promoters to control expression levels

    • Monitoring approach: Track growth curves before and after induction to assess toxicity

  • Oxidative damage:

    • Problem: B. thetaiotaomicron is highly susceptible to oxidative environments

    • Solution: Maintain strict anaerobic conditions during all experimental steps

    • Enhancement strategy: Consider expression in media containing rhamnose, which enhances oxidative stress tolerance

  • Protein degradation:

    • Problem: Proteolytic degradation of the target protein

    • Solution: Include protease inhibitors during extraction and purification

    • Alternative approach: Express in protease-deficient host strains

A systematic troubleshooting approach using DoE methods can help identify the optimal conditions for addressing these challenges while minimizing experimental time and resources .

How can advanced structural biology techniques be applied to study recombinant kdpC from B. thetaiotaomicron?

Advanced structural biology techniques can provide critical insights into kdpC structure, function, and interactions. Methodological approaches include:

  • X-ray crystallography:

    • Approach: Purify recombinant kdpC to high homogeneity, then screen crystallization conditions systematically using sparse matrix screens

    • Challenge: Membrane proteins like kdpC are notoriously difficult to crystallize

    • Solution: Use lipidic cubic phase (LCP) or bicelle crystallization methods specifically designed for membrane proteins

    • Example application: Similar approaches have been used successfully for structural determination of other bacterial membrane proteins, including carbohydrate-binding modules from B. thetaiotaomicron

  • Cryo-electron microscopy (cryo-EM):

    • Approach: Purify the entire Kdp-ATPase complex containing kdpC for single-particle cryo-EM analysis

    • Advantage: Can visualize the protein in a near-native environment without crystallization

    • Technical consideration: Recent advances in direct electron detectors make this increasingly feasible for membrane protein complexes

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Approach: Express isotopically labeled kdpC (^15N, ^13C) for structural determination in solution or micelles

    • Application: Better suited for specific domains rather than the full-length membrane protein

    • Advanced technique: Solid-state NMR can be applied to membrane-embedded kdpC

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Approach: Analyze the solvent accessibility and dynamics of different regions of kdpC

    • Application: Identify conformational changes upon potassium binding or interaction with other Kdp-ATPase components

  • Molecular dynamics (MD) simulations:

    • Approach: Use computational methods to model kdpC structure and dynamics in a lipid bilayer

    • Application: Predict conformational changes during the transport cycle

    • Integration: Combine with experimental structural data for validation and refinement

These advanced techniques, when applied systematically, can provide comprehensive structural insights that inform the functional understanding of kdpC in B. thetaiotaomicron.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.