Recombinant Bacteroides thetaiotaomicron Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Undecaprenyl-diphosphatase (uppP) performs the reaction:

undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate}

This step regenerates UP, a lipid carrier required for transporting cell wall precursors across the cytoplasmic membrane . In B. thetaiotaomicron, this enzyme is implicated in:

  • Polysaccharide metabolism: Facilitating the export of glycans critical for mucosal barrier maintenance and host-microbe interactions .

  • Antibiotic resistance: Conferring bacitracin resistance by maintaining UP pools, as bacitracin inhibits UP recycling .

3.1. Expression Systems

Recombinant uppP is produced in E. coli with tags (e.g., His-tag) for purification. Key parameters include:

  • Purity: >90% as verified by SDS-PAGE .

  • Activity: Enhanced by Ca²⁺ and optimal at pH 7.5–8.0 .

3.2. Research Applications

  • Gut microbiome studies: Investigating B. thetaiotaomicron’s role in modulating host immunity and suppressing pathogens like Clostridioides difficile .

  • Antibiotic development: Targeting uppP to disrupt cell wall synthesis in pathogenic bacteria .

Key Research Findings

  • Suppression of C. difficile toxins: B. thetaiotaomicron’s polysaccharides, dependent on UP transport, reduce toxin production in co-cultures .

  • Oxidative stress resistance: UP-linked metabolic pathways enhance bacterial survival under oxidative conditions, mediated by regulators like RhaR .

  • Host immune modulation: uppP-derived products influence dendritic cell responses, promoting anti-inflammatory cytokines like IL-10 .

Future Directions

Research priorities include:

  • Structural characterization: Solving the crystal structure of B. thetaiotaomicron uppP to refine mechanistic models .

  • Therapeutic potential: Engineering uppP variants or inhibitors for microbiome-based therapies against inflammatory bowel disease (IBD) or antibiotic-resistant infections .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
uppP; bacA; upk; BT_3212; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Target Names
uppP
Target Protein Sequence
MSWLEAMILGLIQGLTEYLPVSSSGHLAIGSALFGIQGEENLAFTIVVHVATVCSTLVIL WKEIDWIFKGLFKFQMNDETRYVINIVISMIPIGIVGVFFKDYVEAIFGSGLMIVGCMLL LTAALLSFSYYYKPRQKDKISMKDAFIIGLAQACAVLPGLSRSGSTIATGLLLGDNKAKL AQFSFLMVIPPILGEALLDSVKMMKGEDVVGDIPALSLIVGFLAAFVAGCLACKWMINIV KKGKLIYFAIYCAIAGLAVIITQL
Uniprot No.

Target Background

Function

Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.

Database Links

KEGG: bth:BT_3212

STRING: 226186.BT_3212

Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bacteroides thetaiotaomicron undecaprenyl-diphosphatase and what is its role in bacterial cell wall synthesis?

Bacteroides thetaiotaomicron undecaprenyl-diphosphatase (uppP) is an essential enzyme (EC 3.6.1.27) that dephosphorylates undecaprenyl diphosphate (Und-PP) to produce undecaprenyl phosphate (Und-P). This reaction is critical because Und-P serves as the lipid carrier that transports cell wall intermediates across the cytoplasmic membrane during peptidoglycan synthesis . The enzyme is also known as Bacitracin resistance protein, as it helps bacteria resist the antibiotic bacitracin by maintaining sufficient levels of Und-P . In B. thetaiotaomicron, uppP is encoded by the gene BT_3212 and functions as an integral membrane protein with multiple transmembrane domains . The disruption of undecaprenyl phosphate metabolism can lead to severe defects in cell wall integrity, making uppP an attractive target for antimicrobial development .

What experimental models are suitable for studying B. thetaiotaomicron uppP function?

Several experimental systems can be employed to study B. thetaiotaomicron uppP function:

  • Recombinant protein expression systems: E. coli expression systems with membrane protein-specific vectors (such as pET or pBAD series) modified with appropriate fusion tags can be used to produce recombinant uppP for biochemical studies .

  • Genetic complementation assays: Utilizing conditional E. coli mutants deficient in undecaprenyl phosphate phosphatases (ΔbacA ΔpgpB ΔybjG) to test the functionality of B. thetaiotaomicron uppP .

  • Mouse colonization models: As B. thetaiotaomicron is a common gut commensal, mouse models with defined microbiota compositions can be used to study the role of uppP in gut colonization and competition .

  • In vitro enzyme assays: Developing phosphatase activity assays using purified recombinant uppP and synthetic undecaprenyl diphosphate substrates to measure enzyme kinetics and inhibitor effects .

When designing these experimental systems, researchers should consider the membrane-bound nature of uppP and the challenges associated with maintaining proper protein folding and activity.

How do mutations in uppP affect bacterial cell wall integrity and antibiotic susceptibility?

Mutations in uppP can significantly impact bacterial cell wall integrity through disruption of the undecaprenyl phosphate cycle, which is essential for peptidoglycan synthesis. Studies in related bacterial systems have shown that defects in undecaprenyl phosphate phosphatases lead to severe morphological abnormalities, including cell enlargement and eventual lysis . This occurs because insufficient levels of Und-P result in compromised peptidoglycan synthesis, weakening the cell wall structure.

Regarding antibiotic susceptibility, uppP mutations typically increase sensitivity to:

  • Cell wall-targeting antibiotics: Reduced uppP function creates synergy with antibiotics that target later stages of cell wall biosynthesis, such as bacitracin, vancomycin, and methicillin .

  • Membrane-active compounds: Compromised cell wall integrity makes bacteria more susceptible to membrane-disrupting agents.

Antibiotic ClassSynergy with uppP InhibitionMechanism
BacitracinStrongDirectly binds to Und-PP, preventing dephosphorylation
VancomycinModerate to StrongBinds to peptidoglycan precursors, blocking transglycosylation
MethicillinModerate to StrongInhibits transpeptidation in peptidoglycan synthesis
Non-cell wall targeting antibioticsMinimal/NoneTarget unrelated cellular processes

Research has demonstrated that benzoic acid derivatives that inhibit UPPP act synergistically with antibiotics known to target bacterial cell wall biosynthesis (fractional inhibitory concentration index, FICI~0.35), but show indifferent effects with non-cell wall biosynthesis inhibitors (FICI~1.45) . This pattern of synergy provides valuable insights for developing combination therapies that target multiple steps in the cell wall biosynthesis pathway.

What is the relationship between uppP activity and B. thetaiotaomicron capsule formation?

The relationship between uppP activity and B. thetaiotaomicron capsule formation is complex and multifaceted. The polysaccharide capsule of B. thetaiotaomicron serves as a protective barrier against various threats, including phage infection, host immune responses, and competition from other bacteria . While uppP primarily functions in peptidoglycan synthesis, the lipid carrier cycle it maintains also impacts capsular polysaccharide biosynthesis.

Research has demonstrated that:

  • B. thetaiotaomicron strains with compromised capsule production show significant disadvantages in competitive colonization scenarios, highlighting the importance of proper capsule formation for in vivo fitness .

  • The lipid carrier undecaprenyl phosphate, which is regenerated through uppP activity, serves as a shared resource between peptidoglycan synthesis and capsular polysaccharide production.

  • Acapsular B. thetaiotaomicron strains exhibit interesting phenotypic characteristics, including a longer lag phase in the gut lumen and slightly slower net growth rates compared to wild-type strains .

A key finding from in vivo studies is that acapsular strains show no colonization defect in mice with low-complexity microbiota but are rapidly outcompeted when facing wild-type strains or a complex microbiota . This suggests that uppP function becomes particularly critical under competitive conditions where efficient resource allocation between cell wall synthesis and capsule formation determines bacterial fitness.

How does inhibition of uppP compare to targeting other enzymes in bacterial cell wall synthesis?

Inhibition of uppP represents a distinctive approach to disrupting bacterial cell wall synthesis compared to targeting other enzymes in the pathway. The comparative advantages and challenges include:

Target EnzymeAdvantages of TargetingChallengesKnown Inhibitors
uppP (UPPP)- Disrupts multiple downstream processes
- Low homology to human enzymes
- Synergizes with existing antibiotics
- Membrane protein (difficult target)
- Multiple isofunctional enzymes in some species
- Bacitracin
- Benzoic acid derivatives
- Lipophilic compounds with electron-withdrawing groups
UPPS- Essential in bacteria
- Not used by humans
- Well-characterized structure
- Some structural similarity to human enzymes
- Potential for resistance
- Tetramic/tetronic acids
- Diamidines
- Benzoic acid derivatives
FPPS- Upstream target affecting multiple pathways- Present in humans (off-target effects)- Bisphosphonates
- Certain carboxylic acids
Transglycosylases- Directly involved in peptidoglycan assembly- Multiple redundant enzymes
- Complex substrate recognition
- Moenomycin
- Vancomycin

Studies have shown that benzoic acid inhibitors targeting both UPPS and UPPP display good correlations between enzyme inhibition and bacterial cell growth inhibition, particularly for compounds with electron-withdrawing substituents such as -NO₂ and -OCF₃ . Importantly, many uppP inhibitors display a significant selectivity index (~1000) between bacterial growth inhibition and human cell toxicity, highlighting their potential as selective antibacterial agents .

What are the optimal conditions for assaying recombinant B. thetaiotaomicron uppP activity?

Establishing optimal conditions for assaying recombinant B. thetaiotaomicron uppP activity requires careful consideration of the enzyme's membrane-bound nature and specific biochemical requirements. Based on experimental approaches used with related phosphatases, the following protocol elements are recommended:

Protein preparation:

  • Express recombinant uppP with appropriate fusion tags to facilitate purification while maintaining enzyme structure and function

  • Use detergent-based extraction methods (e.g., with n-dodecyl-β-D-maltoside or CHAPS) to solubilize the membrane protein

  • Store in Tris-based buffer with 50% glycerol at -20°C for stability

Assay conditions:

  • Buffer composition: 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 0.1% appropriate detergent

  • Temperature: 30-37°C (optimal for B. thetaiotaomicron enzyme activity)

  • Divalent cations: Include 5-10 mM Mg²⁺ as a cofactor

  • Substrate: Synthetic undecaprenyl diphosphate or fluorescent analogs

Activity detection methods:

  • Malachite green phosphate assay: Measures released inorganic phosphate from Und-PP dephosphorylation

  • Radiometric assay: Using ³²P-labeled Und-PP substrate

  • Coupled enzyme assay: Where phosphate release is coupled to a colorimetric or fluorometric readout

Controls and validation:

  • Include bacitracin as a positive control inhibitor (IC₅₀ ≈ 32 μM for related UPPP enzymes)

  • Use heat-inactivated enzyme as a negative control

  • Validate with complementation assays in bacterial strains lacking phosphatase activity

Researchers should note that activity may be affected by the detergent choice, and optimization might be required for the specific recombinant construct being used.

What expression systems are most effective for producing functional recombinant B. thetaiotaomicron uppP?

Producing functional recombinant B. thetaiotaomicron uppP presents significant challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Several expression systems can be considered, each with distinct advantages:

Expression SystemAdvantagesLimitationsRecommendations
E. coli-based systems- Well-established protocols
- High yields
- Cost-effective
- Potential misfolding of membrane proteins
- Toxicity when overexpressed
- Use C41/C43(DE3) strains specialized for membrane proteins
- Control expression with tunable promoters (trc, araBAD)
- Lower expression temperatures (16-25°C)
Yeast systems (P. pastoris, S. cerevisiae)- Better membrane protein folding
- Post-translational modifications
- Scalable
- Longer cultivation time
- Different membrane composition
- Optimize codon usage for yeast expression
- Use methanol-inducible promoters for tight control
Insect cell systems- Excellent for complex membrane proteins
- Near-native folding environment
- Higher cost
- Technically demanding
- Longer production time
- Baculovirus expression vector system (BEVS)
- Consider Sf9 or High Five™ cells
Cell-free systems- Rapid production
- Ability to incorporate non-standard amino acids
- Avoids toxicity issues
- Lower yields
- Higher cost
- May require specialized lipid environment
- Supplement with nanodiscs or liposomes to provide membrane environment

For optimal results with B. thetaiotaomicron uppP, fusion constructs that enhance membrane protein expression and solubility should be considered:

  • N-terminal fusions: MBP (maltose-binding protein), SUMO, or Mistic for improved membrane insertion

  • C-terminal fusions: GFP to monitor folding and expression levels

  • Affinity tags: His₈-tag or FLAG tag for purification purposes

When purifying the recombinant protein, researchers should employ a two-step purification strategy, beginning with affinity chromatography followed by size exclusion chromatography in the presence of appropriate detergents to maintain protein stability and activity .

How can researchers develop specific inhibitors targeting B. thetaiotaomicron uppP?

Developing specific inhibitors targeting B. thetaiotaomicron uppP requires a multifaceted approach that leverages structural information, screening methodologies, and medicinal chemistry optimization. The following systematic strategy is recommended:

1. Structure-based rational design:

  • Utilize homology modeling based on related bacterial phosphatases if crystal structures are unavailable

  • Identify catalytic residues and substrate binding pockets

  • Design compounds that mimic the transition state of the dephosphorylation reaction

2. High-throughput screening approaches:

  • Develop in vitro assays suitable for high-throughput screening (e.g., fluorescence-based phosphatase assays)

  • Screen focused libraries of compounds with physicochemical properties appropriate for membrane protein inhibitors

  • Prioritize lipophilic compounds with anionic groups that may mimic the natural substrate

3. Medicinal chemistry optimization guidelines:
Based on structure-activity relationships observed with related phosphatases, researchers should focus on:

  • Benzoic acid derivatives with electron-withdrawing substituents (-NO₂, -OCF₃) which have shown potent activity

  • Lipophilic side chains of optimal length (C8-C10) to enable membrane penetration and target engagement

  • Avoiding substituents that might hydrogen-bond with water, as these decrease antibacterial activity

4. Validation and specificity testing:

  • Confirm direct target engagement using thermal shift assays or activity-based protein profiling

  • Assess selectivity against human phosphatases

  • Evaluate specificity across different bacterial species

A review of existing data indicates that the most promising inhibitor scaffolds include:

  • 5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid derivatives (ED₅₀ ~ 0.15 μg/mL) that show synergistic activity with cell wall targeting antibiotics

  • Compounds with highly electron-withdrawing ring substituents that maintain a high selectivity index (~1000) between bacterial inhibition and human cell toxicity

For optimal inhibitor development, researchers should avoid compounds with additional ionizable groups, as these generally show poor antibacterial activity despite potential enzyme inhibition in vitro .

How can researchers differentiate between direct uppP inhibition and indirect effects on cell wall synthesis?

Differentiating between direct uppP inhibition and indirect effects on cell wall synthesis requires a comprehensive analytical approach employing multiple complementary methods. This distinction is crucial for accurate characterization of potential inhibitors and understanding their mechanisms of action.

Experimental approaches for establishing direct uppP inhibition:

  • Enzyme inhibition kinetics:

    • Determine inhibition constants (Ki) using purified recombinant uppP

    • Characterize inhibition modes (competitive, non-competitive, uncompetitive)

    • Compare IC₅₀ values against uppP versus other enzymes in the pathway

  • Target validation methodologies:

    • Thermal shift assays to demonstrate direct binding to uppP

    • Resistance mutations in the uppP gene that specifically affect inhibitor sensitivity

    • Overexpression of uppP to observe reduced inhibitor efficacy

  • Correlation analysis:

    • Evaluate structure-activity relationships specifically linked to uppP binding

    • Calculate correlation coefficients between uppP inhibition and bacterial growth inhibition

    • Studies with similar compounds have shown good correlations (r≈0.7-0.8) between enzyme inhibition and cell growth inhibition for true target engagement

Methods to identify indirect effects:

  • Pathway intermediates analysis:

    • Quantify accumulation of undecaprenyl diphosphate and depletion of undecaprenyl phosphate

    • Monitor levels of downstream peptidoglycan precursors (UDP-MurNAc-pentapeptide, Lipid I, Lipid II)

  • Synergy profiling:

    • Test for synergistic interactions with known cell wall inhibitors

    • True uppP inhibitors typically show synergy with other cell wall antibiotics (FICI~0.35) but not with antibiotics targeting other pathways (FICI~1.45)

  • Cell morphology analysis:

    • Electron microscopy to detect specific cell wall defects

    • Time-lapse microscopy to observe characteristic morphological changes associated with uppP inhibition

By implementing this multifaceted approach, researchers can establish with confidence whether observed effects on bacterial growth and cell wall integrity stem directly from uppP inhibition or arise from other mechanisms affecting cell wall synthesis.

What are the challenges in correlating in vitro uppP inhibition with in vivo antibacterial activity?

Correlating in vitro uppP inhibition with in vivo antibacterial activity presents several significant challenges that researchers must address through careful experimental design and data interpretation. These challenges arise from biological, pharmacological, and methodological factors:

1. Membrane permeability barriers:

2. Target accessibility in the cellular environment:

  • uppP is embedded in the membrane, requiring inhibitors to reach the correct membrane leaflet

  • The local membrane environment may differ substantially from detergent-solubilized conditions used in vitro

  • Competition with natural substrates occurs at physiological concentrations

3. Redundancy in phosphatase function:

  • Many bacteria possess multiple undecaprenyl diphosphate phosphatases with overlapping functions

  • In E. coli, four phosphatases (BacA, PgpB, YbjG, and LpxT) can dephosphorylate Und-PP

  • Complete inhibition may require targeting multiple enzymes simultaneously

4. Biological compensation mechanisms:

  • Bacteria can upregulate alternative pathways or modify membrane composition

  • Genetic screens have revealed system-wide connections between Und-P metabolism and various cellular processes, including cell division, DNA repair, and glutathione metabolism

  • These adaptive responses may reduce the efficacy of uppP inhibitors in vivo

5. Methodological considerations:

  • In vitro assays typically use synthetic substrates that may not perfectly mimic natural substrates

  • Different experimental conditions (pH, ionic strength, detergent) affect inhibition potency

  • Enzyme-inhibitor interactions may be affected by protein purification methods and fusion tags

To address these challenges, researchers should:

  • Calculate and compare correlation coefficients between enzyme inhibition and cellular activity

  • Develop cell-based assays that specifically report on uppP function

  • Use genetic approaches (e.g., uppP knockdown strains) to validate target engagement

  • Consider multiparameter optimization of inhibitors to balance enzyme inhibition with suitable physicochemical properties for cellular penetration

How should contradictory results between different uppP inhibition assays be interpreted?

When researchers encounter contradictory results between different uppP inhibition assays, systematic analysis and reconciliation strategies are essential for accurate data interpretation. These discrepancies may arise from various factors inherent to the complex nature of membrane enzyme studies:

Sources of assay discrepancies:

  • Assay format variations:

    • Direct phosphate release assays vs. coupled enzyme systems

    • Detergent-solubilized protein vs. membrane-reconstituted systems

    • Differences in substrate presentation (micelles, liposomes, nanodiscs)

  • Protein construct differences:

    • Variations in fusion tags and their positions (N-terminal vs. C-terminal)

    • Expression systems affecting post-translational modifications

    • Presence of contaminants or partially denatured protein populations

  • Experimental conditions:

    • pH and buffer composition affecting ionization states of inhibitors

    • Temperature variations altering binding kinetics

    • Divalent cation concentrations influencing enzyme activity

Reconciliation strategies:

  • Standardization approach:

    • Establish a reference assay with well-characterized controls

    • Calibrate different assay formats using standard inhibitors (e.g., bacitracin with known IC₅₀ ≈ 32 μM)

    • Develop correction factors to normalize results across platforms

  • Mechanistic investigation:

    • Determine if discrepancies are systematic or compound-specific

    • Characterize inhibition mechanisms (competitive vs. non-competitive)

    • Investigate time-dependent effects (e.g., slow-binding inhibition)

  • Orthogonal validation:

    • Employ multiple assay technologies (fluorescence, colorimetric, radiometric)

    • Confirm direct binding using biophysical methods (SPR, ITC, MST)

    • Validate with cellular assays specific for uppP function

Decision framework for interpreting contradictory data:

ScenarioInterpretation ApproachAction Recommendation
Consistent rank order, different potenciesLikely methodological scaling differencesUse relative potencies rather than absolute values
Compound-specific discrepanciesPotential interfering mechanisms (aggregation, fluorescence quenching)Investigate compound-specific artifacts
Activity in purified system but not in cell-based assaysLikely permeability or efflux issuesOptimize physicochemical properties
Activity in cell-based but not purified assaysPotential prodrug mechanism or indirect effectInvestigate metabolites and alternative targets

When analyzing correlations between different assays, researchers have found that the correlation between enzyme inhibition and bacterial growth inhibition for uppP inhibitors typically ranges from r~0.55 to r~0.7, which is higher than the average correlation observed across different enzyme-cell assay pairs . This provides a useful benchmark for evaluating assay consistency.

How might targeting uppP in B. thetaiotaomicron impact microbiome dynamics in the gut?

Targeting uppP in B. thetaiotaomicron could have significant implications for gut microbiome dynamics due to the organism's important ecological role and the interconnected nature of microbial communities. As a prominent commensal bacterium in the human intestinal microbiota, B. thetaiotaomicron contributes to numerous beneficial functions:

  • Polysaccharide metabolism: B. thetaiotaomicron is specialized in degrading complex plant polysaccharides, contributing to dietary fiber processing .

  • Niche establishment: Its capsular polysaccharides, which depend on undecaprenyl phosphate metabolism, play a crucial role in colonization resistance against pathogens .

  • Immune system education: Interactions with the host immune system help shape appropriate immune responses.

The potential impacts of targeting uppP in this species include:

Direct effects on B. thetaiotaomicron population:

  • Inhibition of uppP would likely reduce B. thetaiotaomicron fitness and colonization ability

  • Studies show that compromised cell wall and capsule synthesis results in longer lag phases and reduced competitive fitness in vivo

  • Acapsular strains show particularly severe fitness defects in competitive colonization scenarios against wild-type strains or complex microbiota

Broader ecological consequences:

  • Reduction in B. thetaiotaomicron populations could create niches for opportunistic pathogens

  • Altered microbial community structure might disrupt metabolic networks dependent on cross-feeding relationships

  • Changes in bacterial surface structures could modify host-microbe interactions and immune responses

Potential therapeutic applications:

  • Selective modulation of B. thetaiotaomicron populations could help reshape dysbiotic communities

  • Targeted suppression might allow for improved engraftment of beneficial bacteria in microbiome-based therapeutics

  • Studies with acapsular B. thetaiotaomicron demonstrate that colonization resistance depends on microbiota complexity, suggesting that timing and community context are critical factors in intervention design

Researchers exploring this area should consider employing gnotobiotic mouse models with defined microbial communities to track population dynamics following suppression of uppP activity. Such studies would help elucidate the broader ecological consequences of targeting this essential enzyme in a key gut commensal bacterium.

What are the prospects for developing narrow-spectrum antibiotics targeting species-specific features of uppP?

The development of narrow-spectrum antibiotics targeting species-specific features of uppP represents a promising frontier in antimicrobial research. This approach offers the potential to selectively target pathogenic bacteria while preserving beneficial members of the microbiome.

Structural and biochemical basis for selectivity:

Despite the conservation of uppP function across bacterial species, there are significant structural and sequence variations that can be exploited for selective targeting:

  • Species-specific binding pockets: Variations in the active site architecture and surrounding residues between bacterial species

  • Membrane composition differences: The local lipid environment of uppP varies between Gram-positive and Gram-negative bacteria

  • Accessory domain variations: Species-specific regulatory domains or protein-protein interaction sites

Current progress and challenges:

ApproachProgressChallengesPotential Solutions
Structure-based designLimited by lack of crystal structures for many species-specific uppP enzymesMembrane protein crystallization difficultiesCryo-EM, computational modeling based on related structures
Ligand-based designSeveral classes of inhibitors identified (benzoic acids, phosphonic acids) Optimizing selectivity while maintaining potencyFragment-based approaches, bioisostere strategies
Biochemical screeningAssays established for measuring uppP activityDeveloping high-throughput screens specific for B. thetaiotaomicron uppPFluorescent substrate analogs, biosensor development

Promising strategies for developing selective inhibitors:

  • Exploiting substrate recognition differences: Benzoic acid derivatives with species-optimized side chains that interact with non-conserved residues

  • Allosteric targeting: Identifying species-specific allosteric sites that modulate enzyme function rather than competing directly at the active site

  • Prodrug approaches: Designing compounds that are selectively activated by enzymes or environmental conditions unique to specific bacterial niches

  • Synergistic combinations: Developing uppP inhibitors that show selective synergy with other antibiotics only in specific bacterial species

The potential advantages of this narrow-spectrum approach include:

  • Reduced disruption of the microbiome during antibiotic treatment

  • Decreased selection pressure for resistance development in non-target bacteria

  • Potential for precisely manipulating mixed bacterial communities

Research has shown that the structure-activity relationships of uppP inhibitors vary between bacterial species, with compounds containing electron-withdrawing groups (-NO₂, -OCF₃) showing differential activity profiles between S. aureus and B. subtilis . These differences provide a foundation for developing species-selective inhibitors based on the unique biochemical properties of B. thetaiotaomicron uppP.

How can synthetic biology approaches enhance our understanding of uppP function and regulation?

Synthetic biology offers powerful approaches to deepen our understanding of uppP function and regulation in B. thetaiotaomicron through precise genetic manipulation, engineered biosensors, and artificial regulatory circuits. These technologies enable researchers to address questions that traditional biochemical and genetic methods cannot easily resolve.

Genetic circuit engineering for studying uppP regulation:

  • Inducible expression systems:

    • Development of titratable promoters specific for B. thetaiotaomicron to control uppP expression levels

    • Creation of feedback-responsive circuits that report on undecaprenyl phosphate availability

    • Engineering genetic toggles to study the consequences of rapid uppP depletion and restoration

  • Reporter systems for monitoring uppP activity in vivo:

    • Fluorescent reporters linked to cell wall stress response pathways

    • FRET-based sensors for detecting changes in undecaprenyl phosphate/diphosphate ratios

    • Growth-coupled selection systems where survival depends on uppP function

Protein engineering approaches:

  • Domain swapping and chimeric enzymes:

    • Creating chimeras between uppP enzymes from different species to identify determinants of substrate specificity

    • Engineering fusion proteins with split fluorescent reporters to monitor protein-protein interactions

    • Developing organelle-targeted variants to explore subcellular localization requirements

  • Active site modifications:

    • Site-directed mutagenesis to create catalytically altered variants

    • Incorporation of non-canonical amino acids to probe reaction mechanisms

    • Engineering allosterically regulated versions of uppP to control activity with synthetic ligands

Whole-cell and community-level applications:

  • Engineered cell-cell communication systems:

    • Bacterial consortia where uppP activity in one species affects signaling to other community members

    • Creation of "sentinel" strains that report on perturbations to cell wall homeostasis

  • Synthetic ecology approaches:

    • Engineering competitive fitness landscapes to study the relationship between uppP function and niche occupation

    • Creating synthetic communities with defined bacterial interactions to study how uppP activity affects community dynamics

  • CRISPR-based technologies:

    • CRISPRi systems for tunable repression of uppP and related genes

    • CRISPR-based mutation library generation to comprehensively map structure-function relationships

    • Genome-wide screens to identify genetic interactions with uppP

The availability of precise genetic tools for B. thetaiotaomicron makes many of these approaches feasible, as research has demonstrated the utility of such techniques for introducing novel functions into this organism . These synthetic biology approaches would complement traditional biochemical studies of recombinant uppP and genetic screens to provide a more comprehensive understanding of this essential enzyme's role in bacterial physiology and community dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.