F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
This protein is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.
KEGG: bvu:BVU_2998
STRING: 435590.BVU_2998
Bacteroides vulgatus ATP synthase subunit b is a 166-amino acid membrane protein with UniProt accession number A6L4M2. The complete amino acid sequence is: MSLLTPDSGLLFWMVIVFGIVFVILAKYGFPVITRMVDERKQYIDKSLLAAREANEQLANIKADSEMILAKAHEEQARILNEAVATRERILKEAKTQAQVEGQKLLDEAKKQIQAEKDSAISDIRRQVAVLSVDIAEKVLRKNLDDEKEQMEMIDRLLDELTVSKD . This protein includes a membrane-spanning region and is encoded by the atpF gene (locus BVU_2998) in Bacteroides vulgatus strain ATCC 8482 . As a component of the F0 sector of bacterial ATP synthase, it contributes to the enzyme's ability to harness proton motive force for ATP synthesis.
The ATP synthase subunit b serves as a critical structural component that connects the membrane-embedded F0 region with the catalytic F1 portion of the ATP synthase complex. Based on structural studies of bacterial ATP synthases, the N-terminal membrane-embedded α-helix of subunit b forms specific interactions with subunit a, which are essential for complex assembly and function . Notably, in bacterial ATP synthases, the two copies of subunit b form different interactions with subunit a - one interacts with transmembrane α-helices 1, 2, 3, and 4, while the other interacts with α-helices 5 and 6 and the loop between α-helices 3 and 4 . These differential interactions explain why mutations in this region often severely impair assembly and activity of the complex. The proper positioning of subunit b is crucial for coupling proton translocation through the membrane to the rotary mechanism that drives ATP synthesis.
Bacterial ATP synthases, including their subunit b components, represent evolutionarily simpler forms of the enzyme compared to their mitochondrial counterparts. While both perform the same core functions, bacterial ATP synthases typically exist as monomers in membranes, whereas mitochondrial enzymes form rows of dimers that contribute to membrane curvature and cristae formation . In bacterial systems like Bacteroides vulgatus, the architecture of subunit b facilitates essential functions with minimal structural complexity. Unlike in mitochondrial systems, bacterial subunit b typically forms a homodimeric peripheral stalk, providing structural support while allowing for the rotational flexibility needed during catalysis. These simpler structural arrangements in bacterial ATP synthases make them valuable models for understanding fundamental aspects of bioenergetic mechanisms.
For expressing Bacteroides vulgatus membrane proteins like ATP synthase subunit b, Escherichia coli has proven to be an effective heterologous expression system. When expressing B. vulgatus membrane proteins in E. coli, researchers should optimize codon usage and consider using specialized E. coli strains designed for membrane protein expression. Evidence from successful expression of other B. vulgatus membrane proteins, such as pyrophosphatase (PPase), supports this approach . The expression construct should include appropriate fusion tags to facilitate detection and purification, while maintaining the protein's native conformation. For optimal results, researchers should test multiple expression conditions, varying parameters such as induction temperature (typically lower temperatures of 16-25°C improve membrane protein folding), inducer concentration, and duration of expression. Expression levels can be monitored via Western blot analysis using antibodies against conserved motifs or fusion tags.
Purification of membrane proteins like B. vulgatus ATP synthase subunit b requires specialized approaches to maintain structural integrity. Begin by isolating inverted membrane vesicles (IMV) from the expression host, as demonstrated with B. vulgatus PPase . For solubilization, select detergents carefully - mild nonionic or zwitterionic detergents like n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS are generally preferred for maintaining native protein conformations. Implement a multi-step purification strategy, typically beginning with affinity chromatography based on fusion tags, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein preparations. Throughout purification, maintain conditions that stabilize the protein, including appropriate pH (usually 7.0-8.0), ionic strength, and potentially glycerol (as used in storage buffers) . Validate protein quality after each purification step using techniques such as SDS-PAGE, Western blotting, and activity assays if applicable.
A multi-faceted approach is essential for verifying both purity and structural integrity of recombinant B. vulgatus ATP synthase subunit b. First, assess purity using SDS-PAGE with Coomassie or silver staining, aiming for >95% homogeneity. Confirm protein identity via Western blot analysis using specific antibodies against conserved ATP synthase motifs, similar to methods used for B. vulgatus PPase detection . For precise mass verification, employ mass spectrometry to compare observed mass with the theoretical mass of 77.0 kDa (as has been done with other B. vulgatus membrane proteins) . Circular dichroism spectroscopy can verify secondary structure content, particularly important for helical membrane proteins. To assess tertiary structure and aggregation state, use techniques such as size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) or analytical ultracentrifugation. Finally, reconstitution into liposomes followed by functional assays can provide the ultimate verification that the purified protein maintains its native conformation and can participate in ATP synthase complex assembly.
For optimal stability of recombinant B. vulgatus ATP synthase subunit b, store the protein at -20°C for routine storage or at -80°C for extended preservation . The recommended storage buffer consists of a Tris-based formulation supplemented with 50% glycerol, specifically optimized for this protein . The high glycerol concentration prevents ice crystal formation during freezing, which would otherwise damage the protein's structure. For working with the protein, prepare small aliquots to avoid repeated freeze-thaw cycles, as these significantly reduce protein stability. These working aliquots can be stored at 4°C for up to one week without significant loss of integrity . For longer-term storage beyond several months, consider flash-freezing samples in liquid nitrogen before transferring to -80°C storage, as this rapid freezing minimizes structural damage to membrane proteins.
To comprehensively evaluate stability of B. vulgatus ATP synthase subunit b, researchers should implement multiple complementary techniques. Begin with thermal stability assays such as differential scanning fluorimetry (DSF) or differential scanning calorimetry (DSC) to determine melting temperatures across different buffer conditions. For membrane proteins like ATP synthase subunit b, detergent screen assays are crucial - test stability in various detergents using techniques like size exclusion chromatography to monitor aggregation over time. Time-course stability studies should be performed at different temperatures (4°C, 25°C, 37°C) with samples analyzed by SDS-PAGE and Western blotting at regular intervals to assess degradation patterns. Additionally, limited proteolysis experiments can reveal subtle conformational changes, as regions with compromised structure will be more susceptible to proteolytic cleavage. Finally, if developing functional assays is possible, monitor activity retention over time as the most relevant measure of stability. Document stability profiles in a comprehensive table comparing various conditions to guide experimental design.
The stability of B. vulgatus ATP synthase subunit b is significantly influenced by buffer composition and additives. The recommended storage buffer contains Tris-based buffer with 50% glycerol , with glycerol serving as a critical cryoprotectant that prevents protein denaturation during freezing. Beyond basic buffer components, consider these stability-enhancing additives: (1) Salt concentration - typically 100-300 mM NaCl or KCl provides ionic strength that shields charge-charge interactions; (2) Divalent cations - low concentrations of Mg²⁺ (1-5 mM) often stabilize membrane proteins; (3) Reducing agents - 1-5 mM DTT or β-mercaptoethanol protect against oxidation of cysteine residues; (4) Protease inhibitors - include a cocktail to prevent degradation during storage; (5) Specific lipids - addition of bacterial lipid extracts or specific phospholipids can significantly enhance stability of membrane proteins by providing a native-like environment. For very long-term storage, lyophilization with appropriate lyoprotectants might be considered, though this requires optimization for membrane proteins. Systematic testing of these additives in different combinations is recommended to determine optimal conditions for maintaining both structural integrity and functional capacity.
Recombinant B. vulgatus ATP synthase subunit b serves as a powerful tool for dissecting bacterial bioenergetic mechanisms through several experimental approaches. First, researchers can perform reconstitution studies where purified recombinant subunit b is incorporated with other ATP synthase components into proteoliposomes to reconstruct functional complexes. This system allows direct measurement of proton translocation coupled to ATP synthesis under controlled conditions. Second, site-directed spin labeling combined with electron paramagnetic resonance (EPR) spectroscopy can map conformational changes in subunit b during the catalytic cycle, providing insights into the dynamic aspects of energy coupling. Third, crosslinking studies similar to those referenced for other bacterial ATP synthases can identify interaction interfaces between subunit b and other components, particularly with the critical a subunit that forms the proton channel . Finally, comparative studies between B. vulgatus ATP synthase components and those from other bacterial species can illuminate adaptation mechanisms in different metabolic niches. These approaches collectively provide a comprehensive view of how ATP synthase subunit b contributes to bacterial energy metabolism, with potential implications for understanding the bioenergetics of human gut microbiome members.
To elucidate structure-function relationships in B. vulgatus ATP synthase subunit b, researchers should implement a multi-dimensional approach combining mutagenesis with structural and functional analyses. Begin with systematic alanine scanning mutagenesis of the protein, particularly focusing on residues in the N-terminal transmembrane helix that forms critical interactions with subunit a . For each mutant, assess both assembly competence (via co-immunoprecipitation with other ATP synthase components) and functional activity (via ATP synthesis/hydrolysis assays in reconstituted systems). High-resolution structural determination methods, such as cryo-EM that has been successfully applied to bacterial ATP synthases , can reveal how specific mutations alter protein conformation and complex assembly. Complement these approaches with molecular dynamics simulations to predict how mutations affect dynamics at atomic resolution. Cross-linking studies using photoactivatable or chemical cross-linkers can experimentally verify predicted interaction interfaces. Finally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides information about regional dynamics and solvent accessibility changes upon mutation. Integration of these datasets will generate a comprehensive model of how specific structural elements of subunit b contribute to its function within the ATP synthase complex.
Comparative analysis of B. vulgatus ATP synthase subunit b with homologs from diverse bacterial species offers unique insights into evolutionary adaptation of this critical bioenergetic machinery. Begin by constructing comprehensive phylogenetic trees of ATP synthase subunit b sequences, similar to those created for membrane pyrophosphatases , to identify major evolutionary clades and signature sequence motifs. Perform detailed sequence alignments to identify conserved residues versus lineage-specific adaptations, particularly in the N-terminal transmembrane region that interacts with subunit a . Express and characterize recombinant subunit b proteins from strategically selected bacterial species representing different evolutionary lineages, metabolic strategies, and environmental niches. Evaluate functional parameters such as assembly efficiency, stability under various conditions, and contribution to ATP synthesis rates when reconstituted with other components. Structural studies using cryo-EM or X-ray crystallography can reveal how sequence divergence translates to structural adaptations. This comprehensive comparative approach will illuminate how natural selection has shaped ATP synthase components to function optimally in different bacterial contexts, potentially revealing how B. vulgatus has adapted its energy metabolism machinery to thrive in the human gut microbiome.
Expression of recombinant B. vulgatus ATP synthase subunit b often encounters several challenges typical of membrane proteins. Low expression yields are common and can be addressed through optimization of codon usage for the expression host, testing different promoter strengths, and screening multiple E. coli strains specifically designed for membrane protein expression (such as C41/C43(DE3) or Lemo21(DE3)). Protein misfolding and aggregation frequently occur and can be mitigated by lowering the expression temperature (16-20°C), reducing inducer concentration, and adding specific membrane protein folding modulators like specific lipids or chemical chaperones to the growth medium. Toxicity to the host cell may arise from membrane protein overexpression; address this by using tightly regulated expression systems and host strains with enhanced membrane protein tolerance. Proteolytic degradation can be combated through co-expression of protease inhibitors, addition of protease inhibitor cocktails during purification, and optimization of cell lysis conditions. For each challenge, implement a systematic troubleshooting approach with controlled variables and clear documentation, similar to optimization strategies that proved successful for expressing other B. vulgatus membrane proteins like PPase in E. coli .
Purifying B. vulgatus ATP synthase subunit b presents specific challenges requiring tailored approaches. For inefficient solubilization, systematically screen multiple detergents (nonionic, zwitterionic, and mild ionic) at various concentrations and temperatures, monitoring extraction efficiency by Western blot. If the protein co-purifies with contaminants, develop a multi-step purification strategy combining orthogonal techniques such as ion exchange chromatography followed by hydroxyapatite chromatography and size exclusion as final polishing step. For aggregation during purification, include stabilizing additives like specific lipids, glycerol (as used in the recommended storage buffer) , or mild detergents throughout the purification process. If the protein shows poor binding to affinity resins, optimize tag placement (N-terminal vs. C-terminal) and linker length, or consider alternative purification strategies like ion exchange chromatography based on the protein's theoretical isoelectric point. For samples showing heterogeneity, implement additional separation techniques like sucrose gradient ultracentrifugation. Throughout troubleshooting, analyze small aliquots at each purification step using analytical techniques including SDS-PAGE, Western blotting, and dynamic light scattering to guide protocol refinement. Document all optimization attempts in a systematic table to track improvements in purity and yield.
B. vulgatus, as a prominent member of the human gut microbiome, offers unique research opportunities through its ATP synthase components. Recent findings indicating that novel B. vulgatus strains can provide protection against gluten-induced epithelial damage suggest that understanding energy metabolism in this bacterium may reveal mechanisms of microbiome-host interactions. Researchers should investigate how ATP synthase efficiency in B. vulgatus relates to its competitive fitness in the gut ecosystem under different dietary conditions. Comparative studies between ATP synthase components from protective versus non-protective B. vulgatus strains may identify sequence or structural variations that correlate with beneficial host effects. Additionally, exploring how B. vulgatus ATP synthase activity responds to changing gut conditions (pH, nutrient availability, oxygen levels) could illuminate adaptation mechanisms in this important commensal bacterium. These investigations will bridge molecular bioenergetics with microbiome research, potentially revealing how energy metabolism in gut bacteria influences host health.
Structural elucidation of B. vulgatus ATP synthase components, including subunit b, presents opportunities for targeted antimicrobial development. While B. vulgatus itself is generally commensal, the structural insights gained can inform antimicrobial strategies against pathogenic Bacteroidetes. Begin by obtaining high-resolution structures of B. vulgatus ATP synthase complexes using cryo-EM, similar to approaches used for Bacillus PS3 ATP synthase . Pay particular attention to the unique features of the b subunit's interaction with subunit a, as these interfaces could represent species-specific targets. In silico screening can identify small molecules that selectively bind to critical regions of bacterial ATP synthases not conserved in mammalian homologs. Structure-based design of peptide inhibitors targeting the b-a interface could selectively disrupt ATP synthase assembly in specific bacterial species. Importantly, comparative structural analysis between ATP synthases from beneficial gut bacteria like B. vulgatus and pathogenic species can guide the development of narrow-spectrum antimicrobials that preserve beneficial microbiome members while targeting pathogens - addressing a critical need in antimicrobial therapeutics.