Recombinant Bacteroides vulgatus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
mscL; BVU_3586; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
Target Names
mscL
Target Protein Sequence
MGKSSFLQDFKAFAMRGNVIDMAVGVIIGGAFGKIVSSIVADVIMPPIGLLVGGVNFTDL KLQLKPAEVVDGVEKAAVTLNYGNFLQATFDFIIIAFSIFLFIRLLAKLNRKKEEVPAPA APPAPSKEEVLLTEIRDLLKEQAGKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating intracellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and functional mechanism of bacterial MscL channels?

Bacterial MscL channels function as biological "emergency release valves" that respond to mechanical tension in the cell membrane. The structural organization of MscL typically includes:

  • An N-terminal amphipathic helix (S1) on the cytoplasmic side

  • Two transmembrane helices (TM1 and TM2) connected by a periplasmic loop

  • A cytosolic helical bundle at the C-terminus

The pore is lined by TM1 from each subunit of the homopentameric complex. During membrane tension, the channel opens like a camera iris to form a non-selective pore with an estimated diameter of ~30 Å, resulting in a large conductance of ~3 nS . This allows rapid release of solutes and prevents cell lysis during hypoosmotic shock. The B. vulgatus MscL follows this general architecture, though with specific amino acid variations that may influence its tension sensitivity and gating kinetics .

What are the optimal expression and purification methods for recombinant B. vulgatus MscL protein?

The recombinant B. vulgatus MscL protein can be effectively expressed in E. coli with an N-terminal His-tag. Based on established protocols, the following methodology is recommended:

Expression System:

  • Host: E. coli (BL21 or similar strain)

  • Vector: pET-based expression system with His-tag fusion

  • Induction: IPTG (0.5-1.0 mM) at OD600 of 0.6-0.8

  • Growth conditions: 37°C pre-induction, 18-25°C post-induction for 4-6 hours

Purification Protocol:

  • Cell lysis using sonication or pressure-based methods in Tris/PBS-based buffer

  • Solubilization of membrane fraction using mild detergents (DDM, LDAO, or OG)

  • Affinity chromatography using Ni-NTA resin

  • Optional: Size exclusion chromatography for higher purity

  • Buffer exchange to storage buffer containing 6% trehalose, pH 8.0

  • Confirmation of >90% purity by SDS-PAGE

The purified protein is typically stored as a lyophilized powder or in solution with 50% glycerol at -20°C/-80°C, avoiding repeated freeze-thaw cycles . Successful incorporation into proteoliposomes or nanodiscs may require optimization of lipid composition to maintain the native conformation and functionality .

What electrophysiological techniques are most effective for studying recombinant B. vulgatus MscL channel activity?

For functional characterization of recombinant B. vulgatus MscL, several electrophysiological approaches are recommended:

Patch-Clamp Methods:

  • Reconstitution into azolectin liposomes or defined lipid bilayers

  • Giant spheroplasts or giant unilamellar vesicles for patch-clamping

  • Planar lipid bilayer recordings for single-channel analysis

Key Parameters to Monitor:

  • Tension threshold for channel activation

  • Single channel conductance (expected to be ~3 nS)

  • Subconductance states during gating transitions

  • Open probability as a function of membrane tension

  • Ion selectivity profile

Tension can be applied either through negative pressure in patch pipettes or by using amphipaths that intercalate into the membrane. For comparative studies, parallel analysis with E. coli MscL is recommended as a reference standard. Researchers should also consider the lipid composition of reconstitution membranes, as this can significantly affect channel gating properties .

How does the MscL channel contribute to B. vulgatus survival in the human gut environment?

B. vulgatus is a prominent commensal bacterium in the human gut, and its MscL channel likely plays critical roles in adaptation to this dynamic environment:

  • Osmotic Stress Management: The gastrointestinal tract undergoes significant osmotic fluctuations due to varying food and water intake. MscL channels help B. vulgatus survive these changes by acting as emergency release valves during hypoosmotic shock .

  • Colonization Advantage: Studies with other Bacteroides species suggest that proper mechanosensation contributes to successful colonization of the gut. The MscL channel may allow B. vulgatus to withstand mechanical stresses during gut peristalsis and mucosal interactions .

  • Cross-talk with Immune Response: While not directly involved in immunomodulation (unlike B. vulgatus LPS), the MscL channel's role in maintaining bacterial membrane integrity may indirectly affect how B. vulgatus interacts with host immune cells in the gut mucosa .

  • Biofilm Formation: Mechanosensitive channels have been implicated in biofilm development in other bacterial species. For B. vulgatus, which can form part of multispecies biofilms in the gut, MscL may contribute to this community lifestyle .

Research comparing wild-type and MscL-deficient B. vulgatus strains in gnotobiotic mouse models would be valuable to further elucidate these physiological roles.

Could the B. vulgatus MscL channel contribute to the anti-inflammatory properties observed with this bacterium?

Multiple studies have documented the anti-inflammatory effects of B. vulgatus in mouse models of colitis, but the specific contribution of MscL remains unexplored . Several hypotheses warrant investigation:

  • Membrane Integrity and Stress Response: MscL's role in maintaining membrane integrity during osmotic stress could indirectly influence which bacterial components (like LPS) are exposed to host immune cells.

  • Metabolite Release: Changes in membrane tension sensed by MscL might regulate the release of bacterial metabolites that have immunomodulatory effects. B. vulgatus produces short-chain fatty acids (SCFAs) like butyric acid and propionic acid that demonstrate anti-inflammatory properties .

  • Survival During Inflammation: During intestinal inflammation, osmotic conditions can change rapidly. MscL may enhance B. vulgatus survival during these periods, allowing continued production of anti-inflammatory factors.

Research comparing the immunomodulatory effects of wild-type B. vulgatus versus MscL knockout mutants would help evaluate this potential connection. Additionally, transcriptomic analysis of B. vulgatus under varying osmotic conditions could reveal coordinated expression between MscL and known immunomodulatory factors .

How do site-directed mutations affect B. vulgatus MscL channel gating properties?

Based on studies of MscL proteins from other bacteria, several key residues and regions are predicted to significantly impact B. vulgatus MscL gating:

TM1 Pore-Lining Residues:
Mutations in the hydrophobic constriction region of TM1 can dramatically alter the tension threshold and stability of the open state. For B. vulgatus MscL, residues in positions equivalent to E. coli's L19, V23, and G26 would be prime targets for mutagenesis .

TM2 Lipid-Facing Residues:
The introduction of tryptophan mutations (similar to the L89W mutation in TbMscL) at the entrance to transmembrane pockets could stabilize expanded subconducting states. In B. vulgatus MscL, residues corresponding to positions M94/A95 in E. coli MscL would be candidates for such studies .

Cytoplasmic Helical Bundle:
Mutations disrupting interactions in the C-terminal domain could affect channel closing kinetics and stability. This region shows variation between B. vulgatus and other bacterial MscL proteins, suggesting potential functional differences .

Experimental approaches combining site-directed mutagenesis with electrophysiological techniques (patch-clamp recordings) and structural studies (PELDOR/DEER spectroscopy, HDX-MS) would be most effective for characterizing these effects .

How do the structural differences between B. vulgatus MscL and E. coli MscL affect their channel properties?

Comparative analysis reveals several structural differences between B. vulgatus and E. coli MscL that may impact their functional properties:

FeatureB. vulgatus MscLE. coli MscLPotential Functional Impact
Protein Length146 amino acids136 amino acidsExtended C-terminal region may affect channel closing kinetics
N-terminal SequenceMGKSSFLQDFMSIIKEFREFDifferent amphipathic properties could alter membrane anchoring
TM2 RegionContains unique residues at lipid-facing positionsWell-characterized lipid interaction sitesMay affect lipid sensing and tension threshold
C-terminal DomainKEEVPAPAAPPAPSKEEVLLTEIRDifferent sequence compositionCould influence oligomerization and channel stability

These structural differences likely translate to functional variations in:

  • Tension Sensitivity: The unique residues in TM domains may result in different tension thresholds for activation.

  • Gating Kinetics: Variations in the C-terminal domain could affect opening and closing rates.

  • Subconductance States: Differences in pore-lining residues may result in unique subconductance behavior.

  • Lipid Interactions: The different lipid-facing residues may lead to distinct lipid preferences and sensitivities.

Advanced spectroscopic methods such as PELDOR combined with MD simulations would be valuable for mapping these structural differences to functional properties .

What approaches can be used to modulate B. vulgatus MscL channel activity for research purposes?

Several approaches can be employed to modulate B. vulgatus MscL channel activity:

Chemical Modulation:

  • Sulfhydryl-Reactive Compounds: Introduction of cysteine residues at strategic locations followed by modification with MTSSL or other sulfhydryl-reactive compounds can alter channel gating .

  • Amphipathic Molecules: Compounds like lysophosphatidylcholine (LPC) that insert into one leaflet of the membrane can induce asymmetric tension and activate MscL channels in the absence of osmotic shock.

  • Photo-Switchable Ligands: Attachment of azobenzene-based photo-switchable compounds to engineered cysteine residues can allow light-controlled activation of MscL.

Genetic Engineering:

  • Gain-of-Function Mutations: Introduction of mutations at pore-lining residues to decrease the gating threshold.

  • Conditional Expression Systems: Development of inducible promoter systems to control MscL expression levels in B. vulgatus.

  • Chimeric Channels: Creation of chimeric constructs combining domains from B. vulgatus MscL with well-characterized regions from E. coli or M. tuberculosis MscL.

Physical Methods:

  • Optical Tweezers: Application of direct mechanical force to membranes containing MscL channels.

  • Acoustic Stimulation: Use of ultrasound to create membrane tension for remote activation.

Each method offers distinct advantages for specific research questions, with chemical modulation being most accessible for initial studies of recombinant protein .

How can structural information about B. vulgatus MscL be leveraged for antimicrobial development?

The structural information of B. vulgatus MscL presents opportunities for antimicrobial development through several strategies:

Selective Targeting Principles:

  • MscL is absent in mammalian cells but present in bacteria, making it an attractive target for antimicrobials with minimal host toxicity .

  • While B. vulgatus is generally beneficial, structural information from its MscL can inform the development of compounds targeting pathogenic bacteria with homologous channels.

Potential Approaches:

  • Gain-of-Function Inducers: Compounds that specifically bind to and activate bacterial MscL channels at sub-threshold tensions, causing inappropriate solute loss and growth inhibition.

  • Structure-Based Design: Using the unique structural features of B. vulgatus MscL as a template for designing compounds that selectively bind pathogenic bacterial MscL homologs.

  • Synergistic Approaches: Combining MscL modulators with conventional antibiotics to enhance bacterial membrane permeability and antibiotic efficacy.

Key Structural Features to Target:

  • The transmembrane pockets identified through the L89W mutation studies provide potential binding sites for small molecules .

  • The periplasmic loop region, which varies significantly between bacterial species, offers opportunities for selective targeting.

  • The cytoplasmic domain, which is involved in channel gating, presents another potential site for modulator binding.

This research direction is particularly relevant given the rising concern about antibiotic resistance and the need for novel antimicrobial targets and mechanisms .

What are the most common challenges in functional reconstitution of recombinant B. vulgatus MscL and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant B. vulgatus MscL:

Challenge 1: Protein Aggregation

  • Cause: Hydrophobic transmembrane domains tend to aggregate during purification

  • Solution:

    • Use milder detergents (DDM or LDAO) at concentrations just above CMC

    • Include 6% trehalose as a stabilizing agent in buffers

    • Perform purification steps at 4°C

    • Consider fusion partners (SUMO, MBP) to enhance solubility

Challenge 2: Low Functional Incorporation into Liposomes

  • Cause: Inefficient protein reconstitution or improper orientation

  • Solution:

    • Optimize protein:lipid ratio (typically 1:200 to 1:1000 w/w)

    • Use gradual detergent removal methods (dialysis or Bio-Beads)

    • Include E. coli polar lipid extract (10-30%) in reconstitution mixtures

    • Verify incorporation using freeze-fracture electron microscopy

Challenge 3: Variable Channel Activity

  • Cause: Heterogeneous protein preparations or lipid environment effects

  • Solution:

    • Implement additional purification steps (ion exchange chromatography)

    • Standardize lipid composition and membrane tension application

    • Include positive controls (well-characterized E. coli MscL) in parallel

    • Use single-channel recordings to assess population homogeneity

Challenge 4: Protein Stability During Storage

  • Cause: Degradation during freeze-thaw cycles

  • Solution:

    • Store as aliquots with 50% glycerol at -80°C

    • For short-term storage, maintain at 4°C for up to one week

    • Reconstitute lyophilized protein in deionized water to 0.1-1.0 mg/mL

    • Add protease inhibitors during storage

Systematic optimization of these parameters is essential for obtaining reproducible functional data with recombinant B. vulgatus MscL.

How can we design experiments to investigate the potential coordination between B. vulgatus MscL channel activity and its immunomodulatory LPS?

Investigating the relationship between B. vulgatus MscL activity and its immunomodulatory LPS requires multidisciplinary experimental approaches:

1. Genetic Manipulation Studies:

  • Create isogenic B. vulgatus strains with wild-type LPS but modified MscL (knockout, gain-of-function)

  • Compare immunomodulatory effects in cell culture and mouse models of colitis

  • Measure LPS release profiles under osmotic stress conditions

2. Real-time Monitoring of LPS Release:

  • Develop fluorescently labeled LPS to track release during osmotic challenges

  • Compare LPS release patterns between wild-type and MscL-mutant strains

  • Correlate MscL activation (via patch-clamp) with LPS release kinetics

3. Structural Biology Approaches:

  • Investigate potential physical interactions between MscL and LPS biosynthesis machinery

  • Use crosslinking studies to identify protein-protein interactions near MscL in the membrane

  • Perform co-localization studies using super-resolution microscopy

4. Transcriptomic/Proteomic Analysis:

  • Compare gene expression profiles of wild-type vs. MscL-mutant B. vulgatus under osmotic stress

  • Identify co-regulated genes involved in LPS biosynthesis and MscL function

  • Analyze membrane proteome changes in response to mechanical stress

5. Immunological Assessment:

  • Test whether MscL activity influences the known anti-inflammatory effects of B. vulgatus LPS

  • Compare DC-SIGN binding of LPS from wild-type vs. MscL-mutant strains

  • Evaluate TLR4/TLR2 activation patterns by LPS released under different MscL activation conditions

This integrated approach could reveal whether mechanical sensing via MscL coordinates with immunomodulatory signaling through LPS in B. vulgatus, potentially explaining some of its beneficial effects in inflammatory conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.