Recombinant Bacteroides vulgatus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant YidC is produced in E. coli with an N-terminal His-tag for affinity purification :

Expression System

  • Host: E. coli C43(DE3) or similar strains

  • Induction: 0.5 mM IPTG at OD<sub>600</sub> = 0.6

  • Solubilization: Cymal-6 detergent

Purification Workflow

  1. Affinity chromatography (TALON/His-tag)

  2. Tag cleavage (3C protease)

  3. Gel filtration (Superdex 200)

ParameterSpecification
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer (6% trehalose, pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Functional Insights

  • Substrate Specificity: Binds hydrophobic transmembrane segments of nascent proteins via its amphiphilic groove .

  • Mechanism: Facilitates lateral release of substrates into the lipid bilayer, either independently or alongside the Sec translocon .

  • Essentiality: Depletion of YidC in E. coli leads to growth arrest, underscoring its critical role .

Key Mutations Impacting Function

ResidueMutationEffectSource
T362 (TM2)T362AComplete loss of activityE. coli studies
Y517 (TM6)Y517ALoss of membrane insertion capacityE. coli studies

Therapeutic Potential

  • Antibacterial Target: YidC depletion sensitizes bacteria to essential oils (e.g., eugenol, carvacrol), suggesting synergy with antimicrobial agents .

  • Gut Microbiome Engineering: B. vulgatus YidC may influence colonization efficiency post-fecal microbiota transplantation (FMT) .

Future Directions

  • Mechanistic Studies: Elucidate substrate recognition motifs in B. vulgatus YidC.

  • Drug Discovery: High-throughput screening for YidC inhibitors using recombinant protein .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
yidC; BVU_3354; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-621
Protein Length
full length protein
Species
Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
Target Names
yidC
Target Protein Sequence
MDKNTLVGFALIGAVVIGFSIYNRPSQEEMARAKHYQDSIQAIAQKEAERLAQAATAQSQ NATLHLDSTSMFYGANQGTEQLTTLENNVVKLTFTNKGGRVCAAILKDYNGQDGKPLMLF DEKDSGMNFAFEGKNENILTEDMYFQPTNVTDSTVTMRLAANNGGYIDFDYKLLPDAYMV NFTIRANGMQNFFPPALNTVNINWRQRARQLEKGFSFEQRYTSLTYKPVEKSSDYLNEMK EAKEDVTDRLDWIAFKNQFFSSVLIADQDFDKASLTSTPQQEGSGYMKNYTADMTTFFDP TGKQPTDMQFYFGPNHFKTLLNSNDLSLSQKDLELEDLVYLGWPIIRWVNRWFTINLFDW LSGWGLSMGVVLLLMTIIVKVLVYPATYKSYMSSAKMRVLKPYINEINAKYPKKEDALKK QQETMALYSKYGVSPMGGCLPMLIQMPVFMALFFFVPNAIELRQQSFLWAPDLSTYDDII NWGTNIPLLGNHLSLFCLLFSITNILNTMYTMKQQDMGQQQMPGMKLMMYIMPVMFIFIF NGYSSGLNYYYFISGLIGILTMVILRKTTDEKKLLAMLEARKEKKSQKNGGKPGGGLMAK LEALQKEQERLQQERMNKGKK
Uniprot No.

Target Background

Function
YidC is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It is involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. YidC also aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its primary function in bacterial membranes?

YidC is a prominent member of the Oxa1 superfamily, essential for bacterial inner membrane biogenesis. It significantly influences membrane protein composition and lipid organization. YidC functions both independently as an insertase and lipid scramblase, and in cooperation with the Sec translocon to aid proper folding of multi-pass membrane proteins . The protein inserts newly synthesized proteins into the membrane through a hydrophobic slide consisting of transmembrane segments TM3 and TM5 . Depletion studies clearly demonstrate YidC's essentiality, as its absence results in cell death .

What structural features of YidC are critical for its insertase function?

The functional core of YidC consists of a membrane-embedded H1/4/5 bundle and a peripheral H0 brace . The hydrophobic slide formed by transmembrane segments TM3 and TM5 constitutes the major substrate contact site . Systematic mutation studies of residues in these regions have revealed their criticality for function. A quintuple serine mutant (termed 5S) with mutations at residues 430, 435, 468, 505, and 509 results in significant growth defects, highlighting the importance of these specific residues in YidC's insertase function .

What are the established substrate proteins of YidC?

YidC has been shown to insert several membrane proteins, including:

  • M13 procoat protein (often used as a model substrate)

  • Pf3 coat protein (another phage-derived substrate)

  • ATP synthase subunit F0c

  • SecG (a protein with two transmembrane segments)

These substrates have been validated through both in vivo co-expression studies and in vitro translation/insertion assays using inverted membrane vesicles (INVs) .

How does YibN interact with YidC and what is the functional significance of this interaction?

YibN has been identified as a bona fide interactor of YidC through multiple complementary approaches:

  • Proximity-dependent biotin labeling (BioID) with YidC-BirA* fusion protein

  • SILAC-based affinity purification-mass spectrometry showing >20-fold enrichment of YibN with His-tagged YidC

  • Native-gel electrophoresis revealing a distinctive band when purified YidC and YibN are incubated together

Functionally, YibN enhances the production and membrane insertion of YidC substrates. Co-expression studies demonstrate that YibN significantly increases the synthesis of YidC substrates like M13 procoat-Lep, Pf3-Lep, and F0c . In vitro assays using inverted membrane vesicles enriched with YibN show a 1.5-1.8-fold stimulation of insertion for multiple substrates .

Additionally, YibN overproduction stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity . Electron microscopy has revealed that YibN production is associated with membrane proliferation, circumvolutions, and multilayered structures primarily at the bacterial inner membrane .

What is the evolutionary relationship between SecY and YidC?

Structural and functional analyses suggest that SecY may have evolved from a dimeric YidC homologue through gene duplication and fusion . This hypothesis is supported by several observations:

  • The hairpin-interrupted three-TMH motif of YidC is strikingly similar to the consensus proto-SecY elements

  • Each consensus helix from the YidC family can be matched to a consensus helix from proto-SecY, with the same connectivity

  • Both proteins share a structural core composed of a membrane-embedded H1/4/5 bundle and a peripheral H0 brace

The similarity between SecY N.H0 and YidC H0 provides particularly strong evidence for homology, as it indicates a conserved structural role rather than convergent evolution driven by function . This evolutionary model has implications for understanding the broader evolution of the general secretory pathway.

How do mutations in YidC's hydrophobic slide differentially affect its functions?

Mutations in YidC's hydrophobic slide can have distinct effects on its various functions:

This differential effect provides crucial insight into the distinct mechanisms by which YidC contributes to these two pathways of membrane protein insertion and helps researchers separate these functions experimentally.

What experimental techniques are most effective for studying YidC-substrate interactions?

Several complementary techniques can be employed to study YidC-substrate interactions:

  • Proximity-dependent biotin labeling (BioID):

    • Fuse a mutant biotin ligase (BirA*) to the C-terminus of YidC

    • Isolate and solubilize the bacterial inner membrane after expression

    • Detect biotinylated proteins by Western Blot

    • Identify interacting proteins by LC-MS/MS analysis

  • SILAC-based affinity purification:

    • Transform recombinant His-tagged YidC into a strain allowing SILAC-labeling

    • Solubilize the membrane fraction and incubate with Ni-NTA agarose beads

    • Identify retained proteins by LC-MS/MS with enrichment ratio calculation

  • Native-gel electrophoresis:

    • Purify His-tagged YidC and potential interacting proteins to homogeneity

    • Analyze proteins by blue-native PAGE to identify distinctive interaction bands

    • Confirm by deletion analysis (e.g., deleting specific transmembrane segments)

  • Co-expression studies:

    • Co-transform plasmids expressing YidC/interactors and substrate proteins

    • Collect time-course aliquots after induction

    • Analyze by SDS-PAGE and Western Blot with appropriate antibodies

How can researchers assess the membrane insertion function of YidC in vitro?

Researchers can quantitatively assess YidC membrane insertion function using in vitro translation/insertion assays:

  • Preparation of inverted membrane vesicles (INVs):

    • Prepare INVs from strains enriched for YidC, YidC interactors (like YibN), or control strains

    • INVs maintain the natural membrane environment while providing access to the cytoplasmic face

  • In vitro translation/insertion assay:

    • Use a cell-free translation system to synthesize substrate proteins

    • Incubate translation products with prepared INVs

    • For simple substrates, assess insertion by measuring protein association with INVs

    • For more complex substrates like SecG, perform proteinase K digestion to identify membrane-protected fragments (MPFs)

  • Comparative analysis:

    • Compare insertion efficiency between INVs from different strains

    • Calculate fold stimulation of insertion relative to control INVs

    • Analyze substrate-specific effects by testing multiple substrates under identical conditions

For example, when testing SecG insertion, three membrane-protected fragments (MPF 1, MPF 2, and inverted SecG) can be detected after proteinase K digestion, all of which are augmented with INVs enriched for YibN .

What approaches are effective for studying YidC depletion in bacterial cells?

Effective approaches for studying YidC depletion include:

  • Conditional expression systems:

    • Place the chromosomal yidC gene under an inducible promoter, such as the arabinose-inducible araBAD promoter

    • Create a strain (like E. coli MK6) where YidC expression can be regulated by adding or removing the inducer

    • Shift to media without inducer or with a repressor to deplete YidC

  • Complementation assays:

    • In a YidC depletion strain, transform plasmids expressing wild-type or mutant YidC

    • Deplete chromosomal YidC by growing in repressing conditions

    • Plate serial dilutions on depletion-maintaining media to assess complementation

  • Phenotypic analysis during depletion:

    • Monitor growth curves during YidC depletion

    • Examine cellular morphology by microscopy

    • Assess the insertion of known YidC substrates by pulse-labeling

    • Analyze membrane protein composition by proteomics approaches

A typical protocol involves growing E. coli MK6 with the chromosomal YidC under arabinose control in LB medium supplemented with chloramphenicol and glucose (0.4%). After reaching an OD600 of 1.0 and allowing at least 3 hours for complete depletion of chromosomal YidC, serial dilutions are performed and plated on appropriate media to assess viability .

What methodological considerations are important when working with recombinant Bacteroides membrane proteins?

For researchers working with recombinant membrane proteins from Bacteroides species, including potential YidC homologs, several methodological considerations are important:

  • Expression systems:

    • Careful selection of expression hosts compatible with Bacteroides membrane proteins

    • Optimization of growth conditions to maximize protein yield while maintaining proper folding

    • Use of inducible promoter systems with tunable expression levels

  • Membrane extraction and protein purification:

    • Selection of appropriate detergents for membrane solubilization (DDM has been successfully used for YidC studies)

    • Affinity tags placement that doesn't interfere with function

    • Purification protocols that maintain protein stability and activity

  • Functional assays:

    • Development of specific assays to assess membrane insertion activity

    • Use of appropriate model substrates relevant to Bacteroides physiology

    • Comparison with established model systems like E. coli YidC

  • Strain-specific considerations:

    • Recognition that different Bacteroides vulgatus strains show varying physiological properties

    • Careful strain selection based on the specific research question

    • Genomic characterization to identify strain-specific variations in membrane proteins

How conserved is the YidC insertase mechanism across different bacterial phyla?

The YidC/Oxa1 superfamily appears to be widely conserved across bacteria, with important implications for understanding membrane protein biogenesis in diverse species:

  • YidC is a prominent member of the Oxa1 superfamily found across bacteria, with homologs in archaea and eukaryotes

  • The core functional elements of YidC, such as the hydrophobic slide formed by transmembrane segments, are likely conserved to maintain its essential role in membrane protein insertion

  • Evidence suggests the existence of YidC homologs across all domains of life, with novel heterodimers formed by archaeal and eukaryotic YidC variants

  • The proposed evolutionary relationship between YidC and SecY suggests that YidC may have pre-dated SecY in evolutionary history, making it an ancient and fundamental component of membrane protein biogenesis machinery

What insights can be gained from studying YidC in diverse bacterial species like Bacteroides compared to model organisms?

Studying YidC across diverse bacterial species offers several important research opportunities:

  • Structural and functional diversity:

    • Identification of conserved and variable regions that inform structure-function relationships

    • Understanding adaptations of the insertase mechanism to different membrane compositions

    • Discovery of lineage-specific interacting partners similar to the YidC-YibN interaction

  • Therapeutic targeting:

    • Given YidC's essential role, comparative studies may reveal species-specific features for antimicrobial development

    • Understanding how gut commensal bacteria like Bacteroides vulgatus utilize membrane insertases may inform probiotic development

  • Evolutionary insights:

    • Testing the hypothesis that SecY evolved from a YidC homolog across different bacterial lineages

    • Investigating potential differences in membrane protein biogenesis pathways between Gram-negative and Gram-positive bacteria

  • Technological applications:

    • Development of optimized membrane protein expression systems based on species-specific insertases

    • Engineering of insertase variants with enhanced properties for biotechnology applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.