Recombinant Bacteroides vulgatus NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Introduction to Bacteroides vulgatus and NADH-quinone oxidoreductase

Bacteroides vulgatus is a prominent gram-negative, anaerobic bacterium belonging to the Bacteroidetes phylum, which constitutes approximately 30% of the human gut microbiota . This bacterium plays a significant role in gut health through its multiple metabolic and immunomodulatory functions. Research has demonstrated that B. vulgatus contributes to maintaining gut homeostasis and integrity while influencing various metabolic processes and immune responses . Its primary metabolic functions include degrading complex carbohydrates and producing short-chain fatty acids (SCFAs), which are essential for intestinal health .

NADH-quinone oxidoreductase, also known as Complex I in the respiratory chain, represents a fundamental enzyme complex in bacterial energy metabolism. This multi-subunit enzyme catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane, creating an electrochemical gradient that drives ATP synthesis. The nuoA subunit specifically functions as one of the membrane-embedded components of this complex, likely participating in proton translocation or structural stabilization of the complex within the bacterial membrane.

Significance in Bacterial Metabolism

In bacterial systems like B. vulgatus, NADH-quinone oxidoreductase serves as the initial enzyme complex in the electron transport chain, playing a pivotal role in energy conservation. By coupling NADH oxidation with proton pumping, this complex contributes significantly to establishing the proton motive force that powers various cellular processes, most notably ATP synthesis via ATP synthase.

Enzymatic Classification

The NADH-quinone oxidoreductase complex, of which nuoA is a component, is classified with the Enzyme Commission (EC) number 1.6.99.5 . This classification places it among oxidoreductases that act on NADH or NADPH with quinones or similar compounds as electron acceptors.

Recombinant Expression Systems

Recombinant B. vulgatus nuoA is produced through molecular cloning and heterologous expression technologies. While specific production methods for this particular protein are not detailed in the available literature, typical approaches involve:

  1. Gene cloning into appropriate expression vectors

  2. Transformation into host expression systems (commonly E. coli)

  3. Induction of protein expression under controlled conditions

  4. Purification using affinity chromatography or other suitable techniques

The tag type for the recombinant protein is determined during the production process to optimize expression and purification .

Metabolic Context in B. vulgatus

  1. Degradation of complex carbohydrates in the gut

  2. Production of short-chain fatty acids (SCFAs) as metabolic end products

  3. Maintenance of redox balance through respiratory and fermentative pathways

The NADH-quinone oxidoreductase complex represents a critical link in coupling carbohydrate oxidation to energy conservation, supporting these metabolic functions that underpin B. vulgatus' ecological role in the gut microbiome.

Potential Relevance to Therapeutic Applications

Recent research has identified B. vulgatus as a potential therapeutic agent for inflammatory bowel disease (IBD) and associated depression . Studies using mouse models have demonstrated that:

  1. B. vulgatus administration significantly reduced disease activity index scores in DSS-induced colitis

  2. Treatment led to less weight loss and longer colon length compared to untreated colitis

  3. The bacterium alleviated depression-like behaviors in both colitis and LPS-induced depression models

Metabolic Products of B. vulgatus

Research has identified several key metabolites produced by B. vulgatus that may mediate its beneficial effects. Notably, p-hydroxyphenylacetic acid (4-HPAA) has been identified as a significant metabolite that can:

  1. Relieve intestinal inflammation in mouse models

  2. Alleviate depression-like behaviors

  3. Improve blood-brain barrier integrity by increasing expression of tight junction proteins like claudin-5

Table 2: Key Metabolites Associated with B. vulgatus Beneficial Effects

MetaboliteFunctionTherapeutic Effect
4-HPAA (p-hydroxyphenylacetic acid)Increases claudin-5 expressionImproves BBB integrity, reduces inflammation, alleviates depression
3-ASAAnti-inflammatoryProtects against colitis
CDCAAnti-inflammatoryProtects against colitis

Potential Connection to Respiratory Metabolism

The production of these beneficial metabolites may be linked to the core metabolism of B. vulgatus, including its respiratory pathways involving NADH-quinone oxidoreductase. The energy generated through electron transport processes supports various biosynthetic pathways that may lead to the production of these bioactive compounds, suggesting an indirect relationship between nuoA function and therapeutic potential.

ELISA Applications

Recombinant B. vulgatus nuoA is commercially available as an ELISA (Enzyme-Linked Immunosorbent Assay) reagent . This format enables various research applications including:

  1. Detection and quantification of anti-nuoA antibodies in experimental or clinical samples

  2. Investigation of protein-protein interactions involving nuoA

  3. Development of diagnostic assays related to B. vulgatus presence or abundance

Potential in Microbiome Research

The availability of recombinant nuoA provides opportunities for advancing research in several areas:

  1. Functional characterization of B. vulgatus metabolism in different gut environments

  2. Investigation of host immune responses to specific bacterial components

  3. Development of targeted interventions to modulate B. vulgatus activity in the gut microbiome

Therapeutic Applications

Given the emerging therapeutic potential of B. vulgatus, future research might explore:

  1. Engineering B. vulgatus strains with modified respiratory capacities for enhanced therapeutic effects

  2. Investigating the impact of respiratory metabolism on production of beneficial metabolites like 4-HPAA

  3. Developing targeted approaches to modulate nuoA activity or expression in vivo

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development with the specified tag.
Synonyms
nuoA; BVU_1759; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
Target Names
nuoA
Target Protein Sequence
MYFTLLVVVILTAIALVAVALGIARAISPRSYNSQKGEAYECGIPTRGRSWMQFKVGYYL FAILFLMFDVETVFLFPWAVVVQDLGVYGLFSILFFLVILVLGLAYAWKKGALEWK
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, menaquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, translocating four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of NADH-quinone oxidoreductase subunit A (nuoA) in Bacteroides vulgatus?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the NADH dehydrogenase I complex in Bacteroides vulgatus. This protein functions as part of the respiratory chain, specifically in the first committed step of respiration by facilitating electron transfer from NADH to quinone. The nuoA subunit is involved in the H+-pumping NADH:ubiquinone oxidoreductase (NUO) complex, one of several NADH dehydrogenase systems present in Bacteroides species .

In the context of bacterial metabolism, nuoA contributes to energy generation through oxidative phosphorylation under anaerobic conditions. Based on studies of related Bacteroides species, the NUO complex that contains nuoA is thought to be part of a complex respiratory pathway that enables these anaerobic gut bacteria to thrive in the oxygen-limited environment of the human intestine .

How does nuoA differ structurally and functionally between Bacteroides vulgatus and other bacterial species?

  • Unlike Escherichia coli's NUO complex, the B. vulgatus complex appears to lack three genes that code for the soluble portion containing the NADH binding site, suggesting a modified electron transfer mechanism .

  • B. vulgatus, similar to other Bacteroides species, possesses multiple types of NADH dehydrogenases (NUO, NQR, and NDH2), indicating a more versatile respiratory chain compared to many aerobic bacteria .

  • Research on Bacteroides fragilis, a closely related species, shows that different NADH dehydrogenases contribute differentially to respiratory activity, with NQR contributing more than 65% of NADH:quinone oxidoreductase activity under anaerobic conditions, while the NUO complex (containing nuoA) may have specialized functions .

What is the genomic organization of the nuoA gene in Bacteroides vulgatus?

The nuoA gene in Bacteroides vulgatus is designated as BVU_1759 in the bacterial genome . It is likely part of an operon encoding multiple subunits of the NADH:quinone oxidoreductase complex, similar to the organization observed in related bacterial species. In B. fragilis, comparative genomic analysis has shown that the nuo operon differs from that of E. coli by lacking three genes coding for the soluble portion of the enzyme complex .

The genomic context of nuoA is important for understanding its regulation and co-expression with other components of the respiratory chain. Research suggests that the organization of respiratory genes in Bacteroides species reflects their adaptation to the anaerobic environment of the human gut, with specialized arrangements that differ from model aerobic organisms.

What are the optimal conditions for expressing recombinant B. vulgatus nuoA protein in heterologous systems?

The expression of recombinant B. vulgatus nuoA requires careful optimization due to its membrane-associated nature and the anaerobic origin of the source organism. Based on current research methodologies:

Expression System Selection:

  • E. coli BL21(DE3) strain is commonly used for expression of bacterial membrane proteins, with modifications to account for the potential toxicity of membrane protein overexpression.

  • Alternative hosts such as Lactococcus lactis or cell-free expression systems may be considered for difficult-to-express membrane proteins.

Expression Conditions:

  • Temperature: Lower induction temperatures (16-20°C) often yield better results for membrane proteins compared to standard 37°C.

  • Induction: Gradual induction with lower IPTG concentrations (0.1-0.5 mM) is preferable to reduce aggregation.

  • Media composition: Enriched media supplemented with glycerol as an additional carbon source can improve yields.

Solubilization and Purification:

  • Detergent screening is crucial, with mild detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS often providing better results for maintaining protein structure and function.

  • Purification buffers should contain glycerol (typically 50%) for protein stability, as indicated in storage conditions for the recombinant protein .

For research applications requiring functional protein, it's important to note that proper folding and membrane integration should be verified through activity assays measuring NADH oxidation and quinone reduction, similar to methodologies applied to other Bacteroides NADH dehydrogenases .

How can researchers effectively design experiments to study the role of nuoA in B. vulgatus respiratory pathways?

Designing effective experiments to study nuoA's role in B. vulgatus respiratory pathways requires a multifaceted approach:

1. Genetic Manipulation Strategies:

  • Generate clean deletion mutants (ΔnuoA) using allelic exchange techniques adapted for Bacteroides species.

  • Create complemented strains where the nuoA gene is reintroduced to verify phenotype specificity.

  • Consider constructing double or triple mutants lacking multiple NADH dehydrogenases to assess functional redundancy, similar to approaches used with B. fragilis (e.g., ΔnqrF ΔnuoO mutant) .

2. Enzyme Activity Measurements:

  • NADH oxidation assays using membrane fractions from wild-type and mutant strains to quantify changes in activity.

  • Quinone reduction assays to directly measure electron transfer efficiency.

  • Proton pumping assays to assess the contribution of nuoA to establishing proton gradients.

3. Physiological Characterization:

  • Growth curves under various carbon sources and stress conditions to identify conditions where nuoA function is most critical.

  • Oxygen sensitivity testing, given the anaerobic nature of B. vulgatus.

  • Competition assays between wild-type and mutant strains in complex growth conditions.

4. In vivo Colonization Studies:

  • Gnotobiotic mouse models to assess the importance of nuoA for gut colonization.

  • Metagenomic and transcriptomic analyses to evaluate nuoA expression in different gut regions.

Example Experimental Design Table:

Experimental ApproachMethodsExpected OutcomesControls
Genetic AnalysisDeletion mutant construction, RNA-seqIdentification of nuoA-dependent gene expressionWild-type, complemented strain
Biochemical CharacterizationMembrane fraction isolation, NADH oxidation assaysQuantification of nuoA contribution to NADH dehydrogenase activityHeat-inactivated samples
Physiological AssessmentGrowth curve analysis, stress responseDetermination of growth conditions requiring nuoAOther NADH dehydrogenase mutants
In vivo StudiesGnotobiotic mouse colonizationAssessment of nuoA role in gut establishmentComplemented strain

What techniques are most effective for purifying recombinant nuoA while maintaining its structural integrity?

Purifying membrane proteins like nuoA while preserving their structural integrity presents significant challenges. Based on current research methodologies:

Extraction and Solubilization:

  • Membrane isolation: Differential centrifugation followed by sucrose gradient ultracentrifugation to obtain highly enriched membrane fractions.

  • Detergent selection: Critical for nuoA integrity - screen multiple detergents including:

    • n-Dodecyl-β-D-maltoside (DDM): Often effective for respiratory complex proteins

    • Digitonin: Preserves supramolecular interactions

    • CHAPS: Milder zwitterionic detergent

  • Solubilization conditions: Optimize detergent:protein ratio, temperature, and buffer composition with stabilizing agents.

Purification Strategy:

  • Affinity chromatography: His-tag purification with imidazole gradient elution under optimized detergent conditions.

  • Size exclusion chromatography: To separate properly folded protein from aggregates and confirm oligomeric state.

  • Ion exchange chromatography: As a polishing step if higher purity is required.

Structural Integrity Verification:

  • Circular dichroism (CD) spectroscopy to assess secondary structure retention.

  • Thermal shift assays to evaluate protein stability under various buffer conditions.

  • Limited proteolysis to confirm proper folding.

  • Activity assays measuring NADH oxidation to confirm functional integrity.

Storage Recommendations:
Based on commercial preparations, purified nuoA should be stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

Critical Considerations:

  • The entire purification process should be performed at 4°C to minimize protein degradation.

  • Inclusion of protease inhibitors is essential throughout all purification steps.

  • For structural studies, consider nanodiscs or amphipol reconstitution to better mimic the native membrane environment.

How can researchers analyze the impact of nuoA mutations on B. vulgatus respiratory function and gut colonization capacity?

Analyzing the impact of nuoA mutations requires sophisticated approaches that connect molecular function to ecological fitness:

Mutational Analysis Strategy:

  • Site-directed mutagenesis targeting:

    • Conserved residues in transmembrane domains

    • Putative quinone-binding sites

    • Interface regions between subunits

  • Construction of chimeric proteins with homologous subunits from different species to identify species-specific functional domains.

Functional Characterization:

  • Enzymatic assays comparing wild-type and mutant proteins:

    • NADH oxidation rates

    • Quinone reduction kinetics

    • Proton translocation efficiency

  • Membrane potential measurements using fluorescent probes to assess the impact on energy conservation.

  • Respiratory chain flux analysis using oxygen consumption rates (if microaerobic conditions are used) or alternative electron acceptor reduction rates.

In vitro Competition Assays:

  • Mixed culture experiments between wild-type and mutant strains under nutrient limitation.

  • Biofilm formation capacity comparison to assess community integration abilities.

In vivo Colonization Analysis:

  • Gnotobiotic mouse models comparing:

    • Initial colonization efficiency

    • Long-term persistence

    • Spatial distribution across gut compartments

  • Multi-omics approaches:

    • Transcriptomics to assess compensatory gene expression

    • Metabolomics to identify altered metabolic pathways

    • Metaproteomics to confirm protein expression levels in vivo

Data Integration Framework:
Researchers should implement a systems biology approach that integrates these multiple data types to create a comprehensive model of how nuoA mutations affect cellular energetics and ultimately influence ecological fitness in the gut environment.

Studies with related Bacteroides species have demonstrated that respiratory chain components can significantly impact colonization. For instance, in B. fragilis, double mutants lacking multiple NADH dehydrogenases showed significant growth defects, suggesting functional redundancy that would need to be carefully analyzed in B. vulgatus as well .

What is the relationship between B. vulgatus nuoA function and the organism's ability to modulate host lipid metabolism?

Recent research has established connections between B. vulgatus and lipid metabolism, though the specific contribution of nuoA requires further investigation:

Mechanistic Connections:

  • B. vulgatus has been shown to ameliorate lipid metabolic disorders , and its respiratory function (potentially involving nuoA) may be crucial for:

    • Production of short-chain fatty acids (SCFAs) that influence host lipid metabolism

    • Modulation of bile acid metabolism through altered bacterial metabolism

    • Bacterial survival and persistence in the gut environment

Experimental Approaches to Establish nuoA's Role:

  • Metabolomic comparison between wild-type and nuoA mutant strains:

    • Profile of secreted metabolites, particularly SCFAs

    • Changes in bile acid transformation capacity

  • Transcriptomic analysis of host tissues upon colonization:

    • Liver gene expression related to lipid metabolism

    • Intestinal expression of transporters and metabolic enzymes

  • In vivo studies using gnotobiotic mouse models fed high-fat diets:

    • Comparison of lipid profiles in mice colonized with wild-type vs. nuoA mutant

    • Assessment of inflammatory markers related to metabolic dysfunction

Potential Mechanisms Table:

Respiratory FunctionMetabolic ImpactPotential Host Effect
NADH oxidation efficiencySCFA production profileRegulation of lipogenesis
Energy conservationBacterial community structureMicrobiome diversity impact on metabolism
Redox balance maintenanceBile acid transformationAltered FXR/TGR5 signaling in host
Electron flow regulationOxygen consumption in gutIntestinal redox status affecting metabolism

Research has shown that B. vulgatus treatment reduced the ratio of Firmicutes to Bacteroidetes in high-fat diet-fed rats , a parameter often associated with metabolic health. The connection between respiratory function, bacterial fitness, and this microbiome modulation represents an important research direction.

How does the expression and activity of nuoA in B. vulgatus change under different environmental conditions relevant to the human gut?

Understanding how nuoA expression and activity respond to changing gut conditions is crucial for characterizing its role in B. vulgatus adaptation:

Key Environmental Variables:

  • Oxygen gradients (strict anaerobiosis to microaerobiosis)

  • pH fluctuations (pH 5.5-7.5 across different gut compartments)

  • Nutrient availability (carbon source variations)

  • Bile acid concentrations

  • Host-derived inflammatory mediators

Experimental Approaches for Expression Analysis:

  • Transcriptomics:

    • RNA-seq under varying environmental conditions

    • Quantitative RT-PCR validation of nuoA expression changes

  • Proteomics:

    • Targeted MS/MS quantification of nuoA protein levels

    • Membrane proteome analysis for respiratory complex composition

  • Reporter gene assays:

    • Promoter-reporter fusions to monitor real-time expression changes

    • Protein-reporter fusions to assess localization and abundance

Activity Measurement Under Varying Conditions:

  • Membrane vesicle preparations to measure NADH dehydrogenase activity across:

    • pH range (5.5-8.0)

    • Different carbon sources

    • Varying bile acid concentrations

    • Oxygen tensions

  • Whole-cell respiration measurements with alternative electron acceptors

  • Redox balance analysis through NAD+/NADH ratio determination

Expected Response Patterns:
Based on studies in related species, nuoA expression and activity may show:

  • Upregulation under energy-limited conditions

  • Modulation in response to carbon source availability

  • Potential coordination with other respiratory complexes (e.g., NQR, NDH2) for adaptive energy conservation

These approaches will help researchers establish how B. vulgatus modulates its respiratory chain components like nuoA to adapt to the dynamic gut environment, potentially contributing to its role in metabolic health and ability to produce beneficial metabolites like SCFAs.

What are the main challenges in studying membrane-bound proteins like nuoA, and what methodological approaches can overcome these limitations?

Membrane proteins like nuoA present several research challenges that require specialized approaches:

Challenge 1: Structural Characterization

  • Limitation: Difficult to obtain high-resolution structural data due to hydrophobicity and instability outside the membrane environment.

  • Solutions:

    • Cryo-electron microscopy (cryo-EM) with gentle extraction in suitable detergents

    • Solid-state NMR specifically optimized for membrane proteins

    • X-ray crystallography with lipidic cubic phase or bicelle crystallization methods

    • Computational modeling using alpha-helical membrane protein prediction algorithms

Challenge 2: Functional Reconstitution

  • Limitation: Loss of activity during purification and difficulty assessing function outside native membrane.

  • Solutions:

    • Proteoliposome reconstitution using defined lipid compositions

    • Nanodiscs for single-molecule studies and stabilization

    • Native electrophoresis techniques to preserve protein-protein interactions

    • Whole-cell assays with specific inhibitors to dissect contribution of different respiratory complexes

Challenge 3: Expression and Purification

  • Limitation: Low expression levels, toxicity, and inclusion body formation.

  • Solutions:

    • Specialized expression hosts (C41/C43, Lemo21)

    • Fusion partners optimized for membrane proteins (Mistic, SUMO)

    • Cell-free expression systems with supplied lipids or detergents

    • Codon optimization for heterologous expression

Challenge 4: Assessing In Vivo Relevance

  • Limitation: Difficult to connect biochemical findings to physiological importance.

  • Solutions:

    • Complementation assays with point mutants to connect structure to function

    • Bioenergetic measurements in intact cells

    • Competition assays under physiologically relevant conditions

    • In situ approaches like FISH-PLA (Fluorescence In Situ Hybridization-Proximity Ligation Assay) to study protein interactions in their native context

Methodological Decision Tree for nuoA Studies:

  • For initial characterization:

    • Begin with membrane vesicle preparations to assess native activity

    • Use genetic knockout studies to determine physiological importance

  • For detailed mechanistic studies:

    • Progress to detergent-solubilized protein for preliminary biochemical analysis

    • Advance to reconstituted systems for definitive mechanistic insights

  • For structural insights:

    • Start with computational prediction and homology modeling

    • Progress to experimental structure determination as technologies and methods mature

By employing these complementary approaches, researchers can overcome the inherent challenges of studying membrane-bound proteins like nuoA .

How can researchers differentiate between the specific functions of nuoA and other NADH dehydrogenase complexes in B. vulgatus?

Differentiating between the functions of multiple NADH dehydrogenase complexes requires strategic experimental design:

Genetic Approach:

  • Generate single, double, and triple mutants lacking various combinations of NUO (containing nuoA), NQR, and NDH2 components.

  • Compare phenotypes under various growth conditions to identify specific functions.

  • Use complementation with wild-type and mutated versions to confirm specificity.

Biochemical Discrimination:

  • Selective inhibitor profiling:

    • Piericidin A (NUO-specific inhibitor)

    • Flavone (NDH2 inhibitor)

    • Silver ions (NQR inhibitor)

  • Electron donor/acceptor specificity:

    • Test different quinone analogs for preferential interaction

    • Assess NADH vs. NADPH specificity

  • Ion pumping activity measurement:

    • H+ translocation (NUO)

    • Na+ translocation (NQR)

    • No ion pumping (NDH2)

Proteomic Analysis:

  • Blue native PAGE to isolate intact respiratory complexes

  • Cross-linking mass spectrometry to map protein-protein interactions

  • Membrane subfraction analysis to determine localization patterns of different complexes

  • Membrane fraction activity assays from single-deletion mutants to quantify relative contributions

  • pH and ion dependence profiles to distinguish between complexes

  • Kinetic analysis with varying substrate concentrations to identify differences in substrate affinity

Example Data Table from B. fragilis Research as a Model:

StrainNADH Oxidation Activity (%)Predominant Environmental NicheGrowth Phenotype
Wild-type100Diverse gut environmentsRobust under all conditions
ΔnuoA~75-80 (estimated)Specialized niches requiring H+ gradientMinimal effect in rich media
ΔnqrF~35Environments with high Na+ concentrationReduced growth in rich media
ΔnuoA ΔnqrFSeverely reducedHighly restrictedSignificant growth defect

These approaches would allow researchers to specifically attribute functions to nuoA-containing complexes versus other NADH dehydrogenases in B. vulgatus, building on the framework established in related Bacteroides species .

What quality control methods should be employed to ensure the reliability of recombinant nuoA protein for functional studies?

Ensuring the reliability of recombinant nuoA for functional studies requires rigorous quality control:

1. Purity Assessment:

  • SDS-PAGE analysis with both Coomassie and silver staining

  • Western blot verification using anti-His tag antibodies or nuoA-specific antibodies

  • Mass spectrometry confirmation of protein identity with coverage analysis of key functional domains

2. Structural Integrity Verification:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure content (expected high alpha-helical content for membrane proteins)

  • Thermal shift assays to determine stability under experimental conditions

  • Limited proteolysis patterns compared to native protein

  • Proper folding assessment through intrinsic tryptophan fluorescence

3. Functional Activity Testing:

  • NADH:quinone oxidoreductase activity using purified protein or membrane fractions

  • Comparison with activity from native B. vulgatus membranes

  • Assessment of activity dependence on pH, temperature, and ionic conditions

  • Inhibitor sensitivity profiling with known respiratory complex inhibitors

4. Membrane Integration Analysis:

  • Sucrose gradient ultracentrifugation to confirm association with membrane fractions

  • Detergent resistance as a measure of proper membrane integration

  • Proteoliposome reconstitution efficiency

  • Freeze-fracture electron microscopy to visualize membrane integration

5. Oligomeric State Characterization:

  • Size exclusion chromatography to determine complex formation

  • Blue native PAGE to assess native-like complex assembly

  • Chemical cross-linking followed by mass spectrometry to verify subunit interactions

  • Multi-angle light scattering to determine absolute molecular weight of complexes

Quality Control Checklist and Acceptance Criteria:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE>90% purity by densitometry
IdentityMass Spectrometry>80% sequence coverage, correct MW
Structural IntegrityCD SpectroscopyAlpha-helical content consistent with prediction
Membrane IntegrationSedimentation Analysis>80% association with membrane fraction
Complex FormationBlue Native PAGEPresence of high-MW complex consistent with NUO
Enzyme ActivityNADH Oxidation AssayActivity within 70% of native membrane activity
StabilityThermal Shift AssayTm >40°C in experimental buffers

For storage and handling, researchers should follow established protocols, including storage in Tris-based buffer with 50% glycerol at -20°C or -80°C, avoiding repeated freeze-thaw cycles .

What emerging research directions could expand our understanding of nuoA's role in Bacteroides vulgatus and gut microbiome function?

Several promising research directions could advance our understanding of nuoA's significance:

1. Systems Biology Integration:

2. Host-Microbe Interaction Studies:

  • Investigation of how nuoA function affects B. vulgatus production of metabolites that influence host metabolism

  • Examination of whether nuoA activity modulates B. vulgatus immunomodulatory properties

  • Assessment of how host-derived factors regulate nuoA expression and activity

3. Microbiome Ecology Perspectives:

  • Exploration of how nuoA contributes to B. vulgatus competitive fitness in complex microbial communities

  • Studies on whether nuoA function affects horizontal gene transfer rates or biofilm formation

  • Investigation of spatial distribution of B. vulgatus in relation to oxygen gradients and nuoA expression

4. Structural Biology Frontiers:

  • Application of cryo-electron microscopy to resolve the structure of the entire NUO complex containing nuoA

  • Determination of how nuoA contributes to supercomplex formation with other respiratory components

  • Single-molecule studies to capture the dynamics of electron transfer through the complex

5. Therapeutic Potential Exploration:

  • Analysis of whether modulating nuoA function could enhance B. vulgatus probiotic properties

  • Investigation of potential small-molecule modulators of nuoA activity

  • Assessment of whether nuoA function correlates with B. vulgatus's beneficial effects on lipid metabolism disorders

Given that B. vulgatus has shown promise in ameliorating lipid metabolic disorders and modulating the gut microbiome composition , and considering the fundamental role of respiratory complexes in bacterial physiology, these research directions could yield significant insights into both basic microbial physiology and potential therapeutic applications.

How might CRISPR-Cas9 gene editing technologies be applied to study nuoA function in B. vulgatus?

CRISPR-Cas9 technologies offer powerful approaches for studying nuoA function in B. vulgatus:

1. Precise Genetic Modifications:

  • Generation of clean deletion mutants without polar effects on downstream genes

  • Introduction of point mutations to study specific functional domains

  • Creation of domain swaps between different NADH dehydrogenase complexes

  • Integration of reporter genes for real-time monitoring of nuoA expression

Methodological Considerations for Bacteroides:

  • Optimization of CRISPR-Cas9 delivery methods specific to B. vulgatus

  • Design of efficient guide RNAs targeting nuoA with minimal off-target effects

  • Development of selection/counterselection strategies appropriate for anaerobic bacteria

  • Validation of editing efficiency through sequencing and functional assays

2. High-Throughput Functional Genomics:

  • CRISPR interference (CRISPRi) using catalytically inactive Cas9 (dCas9) to modulate nuoA expression without genetic modification

  • CRISPR activation (CRISPRa) to upregulate nuoA expression to assess gain-of-function effects

  • Creation of CRISPR knockout libraries targeting all components of respiratory complexes for comparative phenotypic screening

  • Multiplexed editing to simultaneously target multiple NADH dehydrogenase components

3. In Situ Studies:

  • Development of CRISPR-based lineage tracing to study B. vulgatus population dynamics in the gut

  • Creation of CRISPR-based biosensors to monitor respiratory activity in living cells

  • Application of CRISPR imaging techniques to visualize nuoA localization and dynamics

Implementation Strategy Table:

ApplicationTechnical ApproachExpected OutcomeConsiderations
Gene KnockoutCRISPR-Cas9 with homology-directed repairComplete elimination of nuoA functionConfirm lack of polar effects
Domain AnalysisCRISPR-mediated point mutationsIdentification of critical residuesMultiple mutations needed
Expression StudiesCRISPRi with dCas9Tunable reduction in nuoA levelsOptimization of guide RNA position
Regulatory AnalysisCRISPRa with activation domainsIdentification of effects of overexpressionMay disrupt stoichiometry
In vivo TrackingCRISPR-based lineage tracingPopulation dynamics in gutStability of genetic markers

This approach would represent a significant advancement over traditional genetic methods used in previous studies of Bacteroides respiratory components , enabling more precise and comprehensive functional characterization of nuoA.

What computational approaches can advance our understanding of nuoA structure-function relationships and its evolutionary significance?

Computational approaches offer powerful tools for understanding nuoA's structure, function, and evolution:

1. Structural Bioinformatics:

  • Homology modeling using known structures of NADH dehydrogenase complexes as templates

  • Molecular dynamics simulations to study nuoA dynamics within the membrane environment

  • Protein-protein docking to predict interactions with other NUO complex subunits

  • Quantum mechanics/molecular mechanics (QM/MM) simulations to model electron transfer mechanisms

2. Evolutionary Analysis:

  • Phylogenetic profiling to trace the evolution of nuoA across bacterial lineages

  • Positive selection analysis to identify adaptively evolving residues

  • Coevolution analysis to detect residues that evolve in a coordinated manner

  • Ancestral sequence reconstruction to infer the functional capabilities of ancestral nuoA proteins

3. Systems Biology Modeling:

  • Constraint-based modeling to quantify the contribution of nuoA to cellular energetics

  • Kinetic modeling of electron transport chain dynamics

  • Genome-scale metabolic modeling incorporating accurate respiratory parameters

  • Agent-based modeling of B. vulgatus populations in simulated gut environments

4. Machine Learning Applications:

  • Deep learning approaches to predict nuoA function from sequence

  • Unsupervised learning to identify patterns in nuoA expression across experimental conditions

  • Network analysis to map nuoA interactions within the cellular protein network

  • Text mining of literature to build comprehensive knowledge graphs around nuoA function

5. Comparative Genomics:

  • Pan-genome analysis across Bacteroides species to identify core and variable regions of nuoA

  • Synteny analysis to examine conservation of genomic context around nuoA

  • Horizontal gene transfer detection to assess the mobility of respiratory genes

  • Comparison of respiratory chain composition across gut microbiome members

Example of a Computational Analysis Pipeline:

  • Sequence Analysis:

    • Multiple sequence alignment of nuoA homologs

    • Identification of conserved motifs and variable regions

    • Prediction of transmembrane topology and functional domains

  • Structural Modeling:

    • Generation of homology models based on related structures

    • Refinement through molecular dynamics simulations

    • Validation using available experimental data

    • Docking with quinone substrates to identify binding sites

  • Functional Prediction:

    • Mapping of conserved residues onto structural models

    • Simulation of electron transfer pathways

    • Prediction of proton translocation mechanisms

    • Identification of potential regulatory sites

  • Evolutionary Analysis:

    • Construction of phylogenetic trees

    • Mapping of functional diversification onto trees

    • Analysis of selection pressures on different domains

    • Comparison with other respiratory complex components

These computational approaches would complement experimental studies and provide valuable insights into nuoA function that might be difficult to obtain through experimental methods alone, particularly for membrane-bound proteins that present significant technical challenges .

How does current research on B. vulgatus nuoA contribute to our broader understanding of gut microbiome functions in health and disease?

The study of B. vulgatus nuoA provides important insights into fundamental aspects of gut microbiome function:

  • Energy Metabolism in the Gut Environment:
    Research on nuoA and other respiratory components reveals how gut anaerobes generate energy in the unique gut environment, illuminating a critical aspect of microbiome establishment and persistence. The complex respiratory chain of Bacteroides species, involving multiple types of NADH dehydrogenases, suggests sophisticated adaptation to the gut ecological niche .

  • Microbiome-Host Metabolic Interactions:
    B. vulgatus has demonstrated capacity to ameliorate lipid metabolic disorders , and its respiratory function may be foundational to this capability. Understanding nuoA's role could help explain how B. vulgatus influences host metabolism through production of specific metabolites or modulation of the gut environment.

  • Bacterial Adaptation and Ecological Fitness:
    Studies of nuoA provide insights into how bacteria adapt to the challenging gut environment, including anaerobiosis, pH fluctuations, and nutrient availability. This knowledge helps explain community assembly and dynamics in the microbiome.

  • Therapeutic Potential:
    B. vulgatus shows promise as a next-generation probiotic , and understanding the role of core physiological processes like respiration (involving nuoA) is crucial for developing effective therapeutic applications. The stable expression and function of these core genes may be essential for consistent probiotic effects.

  • Biomarker Development:
    Knowledge of nuoA function could lead to the development of biomarkers for assessing B. vulgatus metabolic activity in the gut, potentially serving as indicators of gut health or response to interventions.

By bridging molecular mechanisms with ecological and host-interactive functions, research on nuoA contributes to a systems-level understanding of how the gut microbiome influences human health. This research aligns with the growing recognition that detailed mechanistic understanding of key microbiome members is essential for translating microbiome science into clinical applications.

What standardized protocols should researchers adopt for consistent and comparable studies of B. vulgatus nuoA across different laboratories?

To ensure reproducibility and facilitate comparative analysis, researchers should adopt standardized protocols:

1. Strain and Culture Standardization:

  • Use of reference strains (e.g., B. vulgatus ATCC 8482/DSM 1447/NCTC 11154) with complete genome sequences

  • Standardized anaerobic culture conditions (medium composition, temperature, pH)

  • Defined growth phase harvesting (mid-log phase recommended)

  • Quality control metrics for culture purity and physiological state

2. Genetic Manipulation Protocols:

  • Standardized transformation protocols optimized for Bacteroides

  • Consistent genetic markers and selection strategies

  • Validated primer sets for genetic verification

  • Common set of control strains (wild-type, complemented mutant)

3. Biochemical Characterization:

  • Standardized membrane preparation methods

  • Consistent NADH:quinone oxidoreductase activity assay conditions

  • Standard set of inhibitors and concentrations

  • Reference ranges for expected activities in wild-type strains

4. Expression Analysis:

  • Validated reference genes for qRT-PCR normalization

  • Standard RNA extraction protocols for anaerobes

  • Consistent protein extraction methods for membrane proteins

  • Defined antibody specifications for Western blotting

5. Data Reporting Requirements:

  • Complete strain genotype and origin information

  • Detailed growth conditions and media compositions

  • Raw data deposition in appropriate databases

  • Comprehensive statistical analysis approaches

Recommended Methodological Framework:

Research AspectRecommended MethodKey Parameters to ReportQuality Control Measures
Culture ConditionsAnaerobic growth in defined mediaMedia composition, growth phase, OD600Growth curve, contamination checks
Gene ExpressionqRT-PCR with validated referencesPrimer sequences, efficiency, Ct valuesMultiple reference genes, melt curves
Protein AnalysisStandardized membrane fractionationBuffer composition, protein yieldMarker enzyme activities
Enzyme ActivitySpectrophotometric NADH oxidationSubstrate concentrations, temperature, pHPositive controls, inhibitor validation
in vivo StudiesDefined animal models and dietsHousing conditions, diet compositionMicrobiome background assessment

This standardization would address the field's current challenge of integrating findings across different laboratories and experimental systems, ensuring that results related to nuoA function can be meaningfully compared and synthesized into a coherent understanding .

Getting Started: A Stepwise Research Approach

For new researchers, we recommend this staged approach:

  • Foundation Building: Start with literature review focusing on bacterial respiratory chains, Bacteroides physiology, and gut microbiome function

  • Technical Skill Development: Master anaerobic culturing, membrane protein biochemistry, and genetic manipulation techniques

  • Initial Characterization: Begin with expression analysis and phenotypic characterization of wild-type strains

  • Genetic Analysis: Progress to construction and characterization of nuoA mutants

  • Advanced Functional Studies: Develop sophisticated biochemical and in vivo experiments based on initial findings

This structured approach will build the necessary expertise while generating meaningful data at each stage, ultimately contributing to our understanding of this important component of B. vulgatus physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.