Recombinant Bacteroides vulgatus Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Description

Introduction

Bacteroides vulgatus is a prominent species within the human gut microbiota known for its beneficial effects . Research suggests its potential in preventing conditions like colitis and atherosclerotic cardiovascular disease .

Recombinant Bacteroides vulgatus Potassium-transporting ATPase C chain (kdpC)

The KdpFABC system is a high-affinity K+ uptake system, particularly crucial under low-potassium conditions in bacteria . This system is composed of KdpA, KdpB, and KdpC proteins, which work together to transport potassium ions across the cell membrane .

Kdp System and Potassium Transport

Bacteria possess multiple potassium uptake systems to maintain cytoplasmic potassium levels . The KdpFABC system is significant for its role under low-potassium conditions .

Function of KdpC

KdpC is a subunit of the KdpFABC complex, a potassium-transporting ATPase . The KdpFABC complex is essential for bacterial survival in environments where potassium is scarce .

Bacteroides vulgatus and Colitis

Bacteroides vulgatus Bv46 has shown the ability to significantly alleviate symptoms of DSS-induced colitis in mice . This includes reducing the disease activity index (DAI), preventing colon shortening, and alleviating colon histopathological damage .

Impact on Gut Microbiota

B. vulgatus Bv46 can modify the gut microbiota community in mice with colitis, increasing the abundance of Parabacteroides, Bacteroides, Anaerotignum, and Alistipes at the genus level .

Reduction of Pro-inflammatory Cytokines

Treatment with B. vulgatus Bv46 decreased the expression of colonic TNF-α, IL-1β, and IL-6 in DSS-induced mouse colitis in vivo . It also reduced the secretion of TNF-α, IL-1β, and IL-6 in macrophages stimulated by lipopolysaccharide (LPS) in vitro .

Influence on Short-Chain Fatty Acids (SCFAs)

Oral administration of B. vulgatus Bv46 notably increased the contents of fecal SCFAs, especially butyric acid and propionic acid, potentially contributing to its anti-inflammatory effects .

Bacteroides vulgatus and Atherosclerosis

Bacteroides vulgatus is associated with a reduced risk of atherosclerotic cardiovascular disease . Patients with coronary artery disease (CAD) have a significantly lower abundance of B. vulgatus .

Attenuation of Atherosclerosis

Treatment with live B. vulgatus attenuated atherosclerotic lesion formation in atherosclerosis-prone mice, ameliorating endotoxemia, decreasing gut microbial lipopolysaccharide production, and suppressing pro-inflammatory immune responses .

Lipopolysaccharide Levels

Fecal lipopolysaccharide levels in patients with CAD were significantly higher and negatively correlated with the abundance of B. vulgatus .

Relevance of KdpFABC in Other Bacteria

In Azorhizobium caulinodans, the KdpFABC system is regulated by TrkJ in response to extracellular K+ concentrations, where high K+ concentrations repress the expression of KdpFABC via TrkJ .

Transcriptional Regulation

The expression of kdpFABC is induced under low-K+ conditions, while kup, trkAI, and trkJ are constitutively expressed irrespective of the environmental K+ concentration .

Cytoplasmic Potassium Content

Mutants lacking kup and trkA, trkI, or both, exhibit lower cytoplasmic K+ contents under higher extracellular K+ conditions . Additional deletion of trkJ rectifies the low levels of cytoplasmic K+ in these mutants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; BVU_3265; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
Target Names
kdpC
Target Protein Sequence
MKNFIKSFRLTLVFCVFFSVCYILVLWIFAQFAGPNSGNAEVVELNGKVVGAANVGQSFT EDIYFWGRPSCAGDGYDATSSAGSNKGPTNAEYLAEVEARIDTFLKHHPYLSRKEVPAEM VTASGSGLDPDITPDCAYVQVQRVAKARGMSEETVKAIVDKAVEKPFMGIFGTEKVNVLK LNAALEKAK
Uniprot No.

Target Background

Function

The Bacteroides vulgatus Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Potassium-transporting ATPase C chain (kdpC) in Bacteroides vulgatus and how does it compare to homologous systems in other bacteria?

The Potassium-transporting ATPase C chain (kdpC) in Bacteroides vulgatus is a component of the KdpFABC complex, which functions as a high-affinity potassium uptake system. This system is crucial for bacterial adaptation to low potassium environments. While the specific characteristics of B. vulgatus kdpC have not been fully elucidated, comparative analysis with well-studied homologs suggests it plays a critical role in potassium homeostasis. In bacteria such as E. coli, S. aureus, C. acetobutylicum, M. tuberculosis, and S. typhimurium, the KdpFABC complex is regulated by the KdpD/KdpE two-component system (TCS) for its role in K+ uptake . The KdpC subunit is essential for proper assembly and function of the complex, forming part of the structural framework that enables potassium ion transport across the membrane.

When investigating B. vulgatus kdpC, researchers should consider that while the general function may be conserved, the specific regulatory mechanisms might differ. For instance, in M. smegmatis, the KdpE binding motif (22 bp A-rich) differs significantly from other bacterial species, suggesting species-specific regulation of the KdpFABC operon . This indicates that B. vulgatus may possess unique regulatory elements that warrant dedicated investigation.

What physiological conditions trigger expression of the kdpFABC operon in B. vulgatus, and how can these be reproduced experimentally?

The kdpFABC operon expression in B. vulgatus likely responds to multiple environmental signals, with potassium limitation being the primary trigger. Based on studies in related bacterial systems, researchers can trigger kdpFABC expression experimentally through the following approaches:

  • Potassium limitation: Culture B. vulgatus in defined media with carefully controlled K+ concentrations (<10 mM) to induce expression.

  • Osmotic stress: Increasing concentrations of NaCl and NH4Cl have been shown to induce kdpFABC expression in other bacteria .

  • pH variation: Although not consistently observed across all species, pH fluctuations may influence expression in some cases.

  • Combined stress conditions: Simultaneous application of low K+ and high osmolarity often produces stronger induction.

When designing experiments, it's important to note that in some bacterial systems, β-galactosidase activity (indicating kdpFABC expression) increases with rising concentrations of NaCl and NH4Cl, while showing minimal response to changes in sucrose concentration or pH . This suggests that ionic strength rather than osmolarity alone may be a critical factor in regulation. Monitoring expression under these various conditions can provide insights into the specific triggers for B. vulgatus kdpC expression.

What are the optimal conditions for recombinant expression of Bacteroides vulgatus kdpC and what expression systems yield the highest protein quality?

For successful recombinant expression of B. vulgatus kdpC, researchers should consider the following methodological approach:

Expression System Selection:
E. coli BL21(DE3) or derivatives remain the preferred hosts for initial expression trials due to their high transformation efficiency and reduced protease activity. For membrane proteins like kdpC, specialized strains such as C41(DE3) or C43(DE3) often yield better results by accommodating membrane protein overexpression without toxicity.

Vector Design Considerations:

  • Include a C-terminal or N-terminal affinity tag (His6 or Strep-tag II) for purification

  • Consider using inducible promoters (T7 or araBAD) to control expression levels

  • Optimize codon usage for E. coli while maintaining critical B. vulgatus codons that may affect folding kinetics

Expression Conditions Matrix:

ParameterConditions to TestNotes
Temperature16°C, 25°C, 30°CLower temperatures (16-25°C) often improve membrane protein folding
Induction OD6000.4-0.6, 0.8-1.0, 1.2-1.5Mid-log phase typically yields optimal results
Inducer concentration0.1-1.0 mM IPTG or 0.002-0.2% L-arabinoseLower concentrations may reduce inclusion body formation
MediaLB, TB, M9, auto-inductionTB and auto-induction media often increase yield
Expression time4h, 8h, 16h, 24hLonger times at lower temperatures can improve yield

Membrane Extraction Protocol:
For optimal extraction, use a gentle lysis method with lysozyme treatment followed by membrane fraction isolation through differential centrifugation. Solubilize the membrane fraction using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) at concentrations just above their critical micelle concentration.

What methods are most effective for studying the interaction between B. vulgatus kdpC and other components of the KdpFABC complex?

To effectively study interactions between B. vulgatus kdpC and other KdpFABC components, researchers should employ complementary approaches:

Co-immunoprecipitation (Co-IP) Studies:

  • Express epitope-tagged versions of kdpC and other Kdp components

  • Perform crosslinking with membrane-permeable agents such as DSP (dithiobis[succinimidyl propionate])

  • Solubilize membranes with mild detergents that preserve protein-protein interactions

  • Use antibodies against the epitope tag to pull down kdpC and associated proteins

  • Analyze precipitated complexes by Western blotting and mass spectrometry

Bacterial Two-Hybrid (B2H) Analysis:
This approach allows for detection of direct protein-protein interactions within a bacterial cellular context. Fuse kdpC and potential interacting partners to complementary fragments of adenylate cyclase or a similar reporter system to detect interactions through reporter gene activation.

Surface Plasmon Resonance (SPR):
For quantitative measurement of binding kinetics between purified components:

  • Immobilize purified kdpC on the sensor chip

  • Flow purified KdpF, KdpA, or KdpB over the surface

  • Measure association and dissociation rates to determine binding constants

Cryo-electron Microscopy:
For structural characterization of the assembled complex:

  • Purify the intact KdpFABC complex in membrane-mimetic environments

  • Apply samples to grids and flash-freeze

  • Collect image data and perform computational reconstruction to determine structure

When analyzing interactions, it's important to consider that the KdpFABC complex is regulated by the KdpD/KdpE two-component system in many bacteria , which might influence the stability or conformation of the complex under different conditions.

How does the function of kdpC contribute to B. vulgatus adaptation in the human gut microbiome, particularly in inflammatory conditions?

The kdpC component of the KdpFABC complex likely plays a significant role in B. vulgatus adaptation to the dynamic gut environment through several mechanisms:

Potassium Homeostasis in Inflammatory Microenvironments:
During inflammatory bowel disease (IBD), electrolyte balance in the gut lumen is disrupted. The high-affinity KdpFABC system, including kdpC, enables B. vulgatus to maintain intracellular K+ homeostasis under these challenging conditions. This capability may contribute to the observed inverse relationship between B. vulgatus abundance and depression symptoms in IBD patients .

Influence on Anti-inflammatory Properties:
B. vulgatus has demonstrated anti-inflammatory effects in experimental colitis models . The KdpFABC system may support these properties by:

  • Maintaining bacterial metabolism and stress responses during inflammation

  • Enabling production of beneficial metabolites like 4-HPAA, which have been shown to reduce inflammation and protect the blood-brain barrier

  • Contributing to cellular energy balance needed for anti-inflammatory functions

Competitive Advantage in the Microbiome:
Efficient potassium acquisition through the KdpFABC system likely provides B. vulgatus with a competitive advantage in the crowded gut ecosystem, especially during dysbiosis associated with IBD. RNA-seq analysis of B. vulgatus-treated mice showed altered expression of genes involved in cytokine-cytokine receptor interactions and IL-17 signaling pathway , suggesting that potassium homeostasis may indirectly influence host-microbe signaling cascades.

Given that patients with IBD and depression show decreased abundance of B. vulgatus compared to those with IBD without depression , the KdpFABC system's function may be linked to the bacterium's beneficial effects on both gut inflammation and depression-like symptoms.

What is the relationship between B. vulgatus kdpC function and the bacterium's metabolic activities that influence host physiology?

The function of kdpC within the KdpFABC complex appears to be intricately connected to B. vulgatus metabolic activities that affect host physiology through several pathways:

Metabolite Production and Gut-Brain Communication:
B. vulgatus produces 4-hydroxyphenylacetic acid (4-HPAA), a metabolite involved in gut-brain communication that can protect the blood-brain barrier (BBB) . Proper potassium homeostasis maintained by the KdpFABC system likely supports the metabolic pathways required for 4-HPAA production. Experimental evidence shows that B. vulgatus supplementation can decrease BBB permeability in DSS-induced colitis models, with effects similar to direct 4-HPAA administration .

Influence on Host Serotonin Regulation:
B. vulgatus colonization has been associated with reduced concentration of serotonin (5-HT) in both jejunal mucosa and serum . This connection to neurotransmitter regulation may be partially dependent on proper bacterial metabolism, which requires electrolyte balance facilitated by the KdpFABC system.

Obesity and Metabolic Functions:
Mice colonized with B. vulgatus display significantly less weight gain on high-fat diets, reduced fat mass, smaller liver weights, and improved glucose tolerance and insulin sensitivity . These metabolic effects may be supported by:

  • Bacterial production of specific metabolites that influence host lipid absorption

  • Modulation of bile acid metabolism through bile salt hydrolase (BSH) activity

  • Stable bacterial metabolism under varying gut conditions, which relies on systems like KdpFABC

A methodological approach to investigate these relationships would include:

  • Creating kdpC knockout or knockdown strains of B. vulgatus

  • Comparing metabolite profiles between wild-type and mutant strains

  • Conducting gnotobiotic mouse experiments with these strains to observe differential effects on host physiology

  • Performing transcriptomic and proteomic analyses to identify pathways affected by kdpC dysfunction

What computational approaches are most effective for predicting structural features and functional domains of B. vulgatus kdpC?

For comprehensive structural and functional analysis of B. vulgatus kdpC, researchers should implement a multi-layered computational approach:

Homology Modeling Pipeline:

  • Identify suitable templates from structures of KdpC in other bacteria using BLASTP and HHpred

  • Align B. vulgatus kdpC sequence with template sequences using multiple sequence alignment tools (MUSCLE, T-Coffee)

  • Generate multiple model candidates using MODELLER or SWISS-MODEL

  • Refine models through energy minimization using GROMACS or AMBER force fields

  • Validate models using MolProbity, PROCHECK, and VERIFY3D

Transmembrane Topology Prediction:
Apply multiple prediction algorithms including TMHMM, MEMSAT, and TOPCONS to identify transmembrane domains with consensus approaches. For KdpC proteins, accurate prediction of membrane-spanning regions is crucial for understanding complex assembly.

Functional Domain Annotation:
Use InterProScan and Pfam to identify conserved domains, then map these to the homology model. Special attention should be paid to:

  • Regions predicted to interact with KdpB (the catalytic subunit)

  • Conserved residues at predicted protein-protein interfaces

  • Regions that may interact with lipid bilayers to stabilize the complex

Molecular Dynamics Simulations:
Perform simulations of the modeled protein in a lipid bilayer environment to:

  • Assess structural stability over time (100ns-1μs simulations)

  • Identify conformational changes related to potassium transport

  • Calculate binding energies between kdpC and other Kdp subunits

Conservation Analysis:
Compare kdpC sequences across multiple Bacteroides species and other bacterial genera to identify:

  • Universally conserved residues likely critical for function

  • Residues unique to Bacteroides that may confer genus-specific properties

  • Correlation between sequence variations and environmental adaptations

These computational predictions should guide experimental approaches, particularly for site-directed mutagenesis of predicted functional residues and structural studies of the KdpFABC complex.

How can researchers effectively analyze the differential expression of kdpC in B. vulgatus under various environmental conditions?

To comprehensively analyze kdpC expression patterns in B. vulgatus, researchers should employ a multi-faceted approach combining several methodologies:

RNA-Seq Experimental Design and Analysis:

  • Culture B. vulgatus under multiple conditions, including:

    • Varying K+ concentrations (0.1mM to 10mM)

    • Different osmotic stressors (NaCl, NH4Cl at 50-300mM)

    • pH variations (pH 5.5-8.0)

    • Bile acid exposure (primary and secondary bile acids)

    • Gut inflammation mimicking conditions (inflammatory cytokines)

  • Process RNA-Seq data through a specialized pipeline:

    • Perform quality control using FastQC and trimming with Trimmomatic

    • Map reads to the B. vulgatus genome using HISAT2 or STAR

    • Quantify transcripts using featureCounts or HTSeq

    • Normalize count data with DESeq2 or edgeR

    • Identify differentially expressed genes using statistical thresholds (adjusted p-value <0.05, log2FoldChange >1)

  • Analyze the kdpFABC operon in context:

    • Examine co-expression patterns with other genes

    • Perform KEGG pathway analysis to identify enriched pathways, similar to the analysis that revealed cytokine-cytokine receptor interactions and IL-17 signaling pathway in B. vulgatus-treated mice

    • Compare expression patterns with other potassium transporters to identify compensatory mechanisms

Quantitative PCR Validation:
Develop specific primers for B. vulgatus kdpC and use qPCR to:

  • Validate RNA-Seq findings

  • Perform more detailed time-course experiments

  • Examine expression in complex environments such as fecal or intestinal samples

Promoter Analysis and Reporter Systems:

  • Clone the promoter region of the kdpFABC operon upstream of reporter genes (gfp, lacZ)

  • Transform constructs into B. vulgatus or suitable surrogate hosts

  • Measure promoter activity under different conditions to identify specific activating signals

  • Use truncated promoter constructs to map regulatory regions

Chromatin Immunoprecipitation Sequencing (ChIP-Seq):

  • Express tagged versions of the KdpE response regulator

  • Perform ChIP-Seq to identify KdpE binding sites genome-wide

  • Analyze the sequence motif of the binding site, which may be distinct as seen in M. smegmatis where the KdpE binding motif (22 bp A-rich) differs from other bacterial species

This multi-method approach provides complementary data on kdpC expression regulation, enabling the construction of a comprehensive regulatory model.

What are the most promising approaches for investigating the potential role of B. vulgatus kdpC in modulating the host immune response in inflammatory conditions?

Several cutting-edge approaches show promise for elucidating the relationship between B. vulgatus kdpC and host immune responses:

Engineered Bacterial Strains for In Vivo Studies:

  • Generate B. vulgatus strains with:

    • kdpC deletion

    • Point mutations in critical kdpC functional domains

    • Controlled expression (inducible) of kdpC

  • Introduce these strains into gnotobiotic mouse models of inflammatory bowel disease (DSS-induced colitis)

  • Assess differences in:

    • Colitis severity (colon length, histopathology scoring)

    • Cytokine profiles (IL-6, CXCL1, CXCL2 expression patterns)

    • Depression-like behaviors using validated tests (forced swim test, sucrose preference)

    • Blood-brain barrier integrity using Evans Blue tracer dye

Single-Cell Transcriptomics of Host-Microbe Interactions:

  • Isolate immune cells from intestinal tissue of mice colonized with wild-type or kdpC-mutant B. vulgatus

  • Perform single-cell RNA sequencing to identify cell-specific responses

  • Analyze differential expression in key immune cell populations (T cells, macrophages, dendritic cells)

  • Map immunological pathways affected by B. vulgatus and specifically by the kdpC function

Metabolomic Profiling:

  • Compare metabolite profiles in:

    • Wild-type vs. kdpC-mutant B. vulgatus cultures

    • Intestinal contents of mice colonized with different B. vulgatus strains

    • Serum of experimental animals

  • Focus particularly on 4-HPAA levels, which have been shown to protect the blood-brain barrier

  • Use liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify novel metabolites affected by kdpC function

Organoid Co-culture Systems:

  • Establish intestinal organoids from human or mouse tissue

  • Co-culture with wild-type or kdpC-mutant B. vulgatus

  • Measure epithelial responses including:

    • Tight junction protein expression

    • Inflammatory mediator production

    • Transcriptional changes in epithelial cells

These approaches would build on existing evidence of B. vulgatus's anti-inflammatory effects and its ability to alleviate depression-like behavior in colitis models , helping to determine the specific contribution of kdpC to these beneficial properties.

How might understanding B. vulgatus kdpC function contribute to the development of novel therapeutic approaches for inflammatory bowel disease and related conditions?

Understanding B. vulgatus kdpC function has several promising therapeutic implications that researchers can explore through the following approaches:

Engineered Probiotic Development:

  • Create recombinant B. vulgatus strains with optimized kdpC expression for enhanced survival in inflammatory environments

  • Engineer strains that co-express kdpC with other therapeutic proteins (e.g., anti-inflammatory cytokines)

  • Develop delivery systems to protect these engineered bacteria during transit through the upper GI tract

  • Evaluate therapeutic efficacy in preclinical models of IBD and depression

Identification of Microbiome-Based Biomarkers:

  • Assess kdpC expression levels in B. vulgatus from patient samples as potential biomarkers for:

    • Disease progression in IBD

    • Comorbid depression risk

    • Treatment response prediction

  • Develop a panel of microbiome markers including B. vulgatus abundance and functional gene expression

Metabolite-Based Therapeutics:

  • Investigate whether proper kdpC function is required for production of beneficial metabolites like 4-HPAA

  • Evaluate the therapeutic potential of these metabolites independently or in combination

  • Develop synthetic or semi-synthetic analogs with improved pharmacokinetic properties

  • Design targeted delivery systems for these compounds to affected tissues

Precision Microbiome Modulation:

  • Screen compounds that specifically enhance B. vulgatus growth and kdpC expression

  • Develop selective prebiotics that favor B. vulgatus in the competitive gut environment

  • Design combination approaches that enhance potassium availability to B. vulgatus while limiting access to pathogenic species

Translational Research Model:

Therapeutic ApproachExperimental ValidationClinical Application
Engineered B. vulgatusDSS-colitis models with endpoints including cytokine expression Phase I safety trials in healthy volunteers
4-HPAA administrationEvaluate effects on BBB permeability and claudin-5 expression Phase II trials in IBD patients with depression
Selective prebioticMeasure B. vulgatus expansion in complex microbiotaDietary intervention studies
Biomarker panelCorrelate with disease severity and depression scores Companion diagnostics for targeted treatments

These approaches leverage the observed relationship between B. vulgatus abundance and reduced depression symptoms in IBD patients , as well as the bacterium's ability to improve metabolic parameters , potentially opening new avenues for treating these complex conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.