Recombinant Bacteroides vulgatus Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bacteroides vulgatus Protein CrcB homolog (CrcB) is a protein expressed in E. coli and fused to an N-terminal His tag . It is a full-length protein consisting of 121 amino acids . The crcB gene, also known as BVU_3831, encodes a putative fluoride ion transporter CrcB .

Table 1: Recombinant Bacteroides vulgatus Protein CrcB homolog (CrcB) Details

FeatureDescription
Product OverviewRecombinant Full Length Bacteroides vulgatus Protein CrcB homolog(CrcB) Protein (A6L6X8) (1-121aa), fused to N-terminal His tag, was expressed in E. coli.
SpeciesBacteroides Vulgatus
SourceE.coli
TagHis
Protein LengthFull Length (1-121)
FormLyophilized powder
AA SequenceMKSLLLIFLGGGTGSVLRYLLTISIYRQGTTNFPWGTFAVNILGCILIGVFYTLTSRIHINNDIRLMLTIGLCGGFTTFSTFSNESLQLLKSGLYPSFFTYIIGSVVLGILGVMLGIWMSE
PurityGreater than 90% as determined by SDS-PAGE.
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Gene NamecrcB
SynonymscrcB; BVU_3831; Putative fluoride ion transporter CrcB
UniProt IDA6L6X8

Biological Activity and Functions

B. vulgatus has demonstrated potential in attenuating colitis in mice by modulating the immune response . Specifically, it downregulates genes involved in B-cell responses, such as Ccl19, Cd19, Cd22, Cd40, and Cxcr5 . B. vulgatus also reduces the secretion of pro-inflammatory cytokines like TNF-α, IL-1β, and IL-6 in macrophages .

B. vulgatus has been found to produce short-chain fatty acids (SCFAs) such as acetic acid, propionic acid, butyric acid, isobutyric acid, and isovaleric acid . The administration of B. vulgatus leads to increased fecal concentrations of SCFAs, which are known to have beneficial effects on gut health .

Genetic Manipulation and Resistance

Genetic manipulation of Bacteroides species, including B. vulgatus, has been achieved through targeted gene deletion . For instance, the deletion of BVU_1078 in B. vulgatus reduces polymyxin B (PMB) resistance, and restoring its expression complements this defect . This indicates a role for BVU_1078 in PMB resistance in B. vulgatus .

Availability

Recombinant Bacteroides vulgatus Protein CrcB homolog (crcB) is available for ELISA assays . It is supplied as a recombinant protein with a determined tag type, stored in a Tris-based buffer with 50% glycerol .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
crcB; BVU_3831; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
Target Names
crcB
Target Protein Sequence
MKSLLLIFLGGGTGSVLRYLLTISIYRQGTTNFPWGTFAVNILGCILIGVFYTLTSRIHI NNDIRLMLTIGLCGGFTTFSTFSNESLQLLKSGLYPSFFTYIIGSVVLGILGVMLGIWMS E
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bacteroides vulgatus and why is it important in microbiome research?

Bacteroides vulgatus is a prominent gram-negative anaerobic bacterium abundantly found in the human gut microbiome. It represents one of the dominant species within the Bacteroidales order that remains relatively stable over time in healthy individuals. Research has shown that B. vulgatus plays significant roles in maintaining gut homeostasis and has been associated with various health conditions. B. vulgatus and B. uniformis are particularly noteworthy for their abundance in human fecal microbial communities, making them important research subjects for understanding host-microbe interactions . While typically stable in humans, antibiotic treatments can lead to transient changes in strain dominance, suggesting a complex and dynamic strain community exists within the human gut ecosystem .

What is the CrcB homolog protein in Bacteroides vulgatus?

The CrcB homolog in B. vulgatus functions primarily as a fluoride ion channel protein that provides resistance to fluoride toxicity. Similar to CrcB proteins characterized in other bacterial species, the B. vulgatus CrcB homolog likely forms a dimeric ion channel structure embedded in the cell membrane that selectively exports fluoride ions from the cell cytoplasm. This export mechanism helps maintain cellular homeostasis when the bacterium encounters environments with elevated fluoride concentrations. While it shares structural similarities with CrcB proteins from other bacterial species, the B. vulgatus variant may possess unique characteristics related to its regulatory mechanisms and expression patterns that align with the specific environmental challenges faced by gut-resident Bacteroidetes.

How does genetic context influence CrcB homolog expression in B. vulgatus?

The genetic context surrounding the CrcB homolog in B. vulgatus significantly influences its expression patterns. The gene may be regulated by nearby promoters that respond to specific environmental cues such as oxidative stress. Research suggests that subinhibitory H₂O₂ exposure can alter expression patterns of certain B. vulgatus genes . Similar stress-responsive mechanisms might control CrcB expression, particularly when the bacterium encounters environmental challenges. Additionally, the presence of mobile genetic elements in B. vulgatus, as demonstrated by identified conjugative transposons (CTns), suggests potential for horizontal gene transfer events that could affect regulatory networks controlling CrcB expression . Researchers should analyze upstream regulatory elements and surrounding genetic architecture when studying CrcB expression patterns.

What purification strategies are most effective for B. vulgatus CrcB homolog?

Purification of the recombinant B. vulgatus CrcB homolog requires careful consideration of its membrane protein nature. A systematic approach should begin with:

  • Membrane fraction isolation: Use differential centrifugation to separate membrane fractions following cell lysis.

  • Detergent screening: Test multiple detergents (DDM, LMNG, OG) for optimal solubilization while maintaining protein stability and function.

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial capture, with gentle elution conditions.

  • Size exclusion chromatography: Apply as a polishing step to separate monomeric, dimeric, and oligomeric forms.

  • Stability assessment: Monitor protein stability in various buffer compositions using thermal shift assays.

For functional studies, consider maintaining the protein in nanodiscs or proteoliposomes post-purification. Quality control should include SDS-PAGE, Western blotting, and activity assays measuring fluoride transport capability. Since membrane proteins like CrcB often show reduced stability once extracted from the membrane environment, optimizing buffer conditions containing appropriate detergents and stabilizing agents is crucial for maintaining proper folding and activity.

How can researchers optimize yield and solubility of recombinant B. vulgatus CrcB homolog?

Optimizing yield and solubility of recombinant B. vulgatus CrcB homolog requires addressing several experimental parameters:

ParameterStandard ConditionOptimization Strategy
Expression temperature37°CLower to 16-25°C to reduce inclusion body formation
Induction conditions1.0 mM IPTGTitrate IPTG concentration (0.1-0.5 mM) and test autoinduction media
Expression duration4-6 hoursExtend to 16-24 hours at lower temperatures
Fusion tagsHis-tagTest MBP, SUMO, or Thioredoxin fusions to enhance solubility
Media compositionLBEvaluate TB, 2xYT, or M9 minimal media with supplements
Solubilization agentsStandard detergentsScreen multiple detergent classes and amphipols
Lysis conditionsSonicationTest gentler methods like enzymatic lysis with lysozyme

Additionally, for membrane proteins like CrcB, inclusion of molecular chaperones can significantly improve proper folding. Co-expression with chaperones such as GroEL/GroES might be beneficial. For B. vulgatus proteins specifically, consider the potential impact of anaerobic growth conditions on protein folding, as this organism naturally grows in anaerobic environments, which may affect protein structure and stability during recombinant expression.

What are the most reliable methods to assess the function of recombinant B. vulgatus CrcB homolog?

Assessment of recombinant B. vulgatus CrcB homolog function requires multiple complementary approaches:

  • Fluoride ion transport assays: Reconstitute purified CrcB into liposomes loaded with a pH-sensitive fluorescent dye. Measure fluorescence changes upon addition of fluoride ions to quantify transport activity.

  • Electrophysiology: Utilize planar lipid bilayer electrophysiology or patch-clamp techniques to directly measure ion channel conductance and selectivity.

  • Fluoride resistance assays: Complement CrcB-deficient bacterial strains with the recombinant B. vulgatus CrcB and assess growth in media containing varying fluoride concentrations.

  • Binding assays: Employ isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to measure binding affinities for fluoride and other potential ligands.

  • Structural validation: Use circular dichroism (CD) spectroscopy to confirm secondary structure composition and thermal stability.

  • In vivo localization: Generate fluorescent protein fusions to confirm proper membrane localization in model systems.

When interpreting results, consider that membrane environment significantly influences channel activity. Compare findings across different lipid compositions that mimic the native B. vulgatus membrane environment. Additionally, control experiments should include known CrcB variants from well-characterized systems as positive controls and non-functional mutants as negative controls.

How can researchers effectively analyze the structure-function relationship of B. vulgatus CrcB homolog?

Analyzing the structure-function relationship of B. vulgatus CrcB homolog requires a multifaceted approach combining computational predictions with experimental validation:

  • Sequence analysis: Begin with multiple sequence alignments comparing B. vulgatus CrcB with characterized homologs to identify conserved motifs and potential functional domains.

  • Homology modeling: Generate structural models based on known CrcB structures, focusing on transmembrane topology and channel-forming regions.

  • Site-directed mutagenesis: Systematically mutate conserved residues, particularly those lining the predicted channel pore, to assess their contribution to function.

  • Cross-linking studies: Employ cysteine scanning mutagenesis combined with crosslinking agents to validate predicted protein-protein interfaces in the dimeric assembly.

  • Molecular dynamics simulations: Model ion permeation through the channel under different conditions to identify key residues involved in selectivity.

A comprehensive experimental design should include:

  • Alanine scanning of conserved residues

  • Charge-altering mutations of pore-lining residues

  • Cysteine pairs to validate structural proximity via disulfide formation

  • Chimeric constructs with other CrcB homologs to identify species-specific functional domains

The helix-turn-helix motif, similar to that found in regulatory proteins like BVU3433 in B. vulgatus, may serve as a model for understanding DNA-binding domains if CrcB has autoregulatory functions .

What are the recommended approaches for studying interactions between CrcB homolog and other cellular components?

Studying interactions between B. vulgatus CrcB homolog and other cellular components requires multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP): Use epitope-tagged CrcB as bait to pull down interacting partners from B. vulgatus lysates, followed by mass spectrometry identification.

  • Bacterial two-hybrid assays: Employ specialized two-hybrid systems adapted for membrane proteins to screen for potential interacting partners.

  • Proximity labeling approaches: Utilize BioID or APEX2 fusions to CrcB to identify proximal proteins in living cells through biotinylation.

  • Fluorescence microscopy: Employ fluorescence resonance energy transfer (FRET) with fluorescently labeled CrcB and candidate interactors to visualize interactions in vivo.

  • Cross-linking mass spectrometry (XL-MS): Apply chemical cross-linkers to stabilize transient interactions followed by mass spectrometry analysis.

When interpreting results, consider the physiological context of B. vulgatus. RNA-Seq approaches similar to those used for analyzing the conjugative transposon in P. vulgatus can help identify genes co-regulated with CrcB under various stress conditions . Particularly, examine responses to oxidative stress, as H₂O₂ has been shown to affect gene expression in Bacteroides species . This approach may reveal functional associations not detected through direct physical interaction studies.

How does B. vulgatus CrcB homolog function differ under varying environmental conditions?

The function of B. vulgatus CrcB homolog demonstrates significant environmental responsiveness, particularly to conditions relevant to the human gut microenvironment. Research indicates that subinhibitory oxidative stress conditions, such as exposure to H₂O₂, can alter gene expression patterns in B. vulgatus . Similar environmental factors likely influence CrcB function through both direct and regulatory mechanisms.

A systematic investigation should examine:

  • pH dependence: Evaluate channel activity across pH gradients (pH 5.5-8.0) representing various gut microenvironments.

  • Redox sensitivity: Assess functional changes under oxidizing and reducing conditions, particularly important given the demonstrated effect of H₂O₂ on B. vulgatus gene expression .

  • Bile acid exposure: Determine if bile acids common in the gut environment modulate channel activity.

  • Anaerobic vs. aerobic conditions: Compare functional parameters under oxygen-limited conditions that mimic the natural gut environment.

  • Temperature sensitivity: Characterize thermal stability and activity across fever-range temperatures (37-40°C).

Notably, studies on B. vulgatus have shown that exposure to H₂O₂ can cause approximately 4.4-fold decrease in expression of regulatory genes . This suggests that oxidative stress may significantly alter membrane protein expression and function, potentially including CrcB. When designing experiments, researchers should control environmental variables carefully and consider the complex interplay between direct effects on protein function and indirect effects via altered gene expression.

What is the evolutionary significance of CrcB homologs across Bacteroides species?

The evolutionary significance of CrcB homologs across Bacteroides species reveals important insights into adaptation to host-associated environments:

Comparative genomic analyses demonstrate that CrcB homologs represent a conserved adaptation mechanism within the Bacteroidales order. Similar to mechanisms observed with Bacteroidales-specific antimicrobial proteins (BSAPs) , CrcB homologs likely underwent selection pressure related to niche adaptation. The presence and maintenance of CrcB across Bacteroides species suggests fundamental importance to survival in the gut environment.

Evolutionary patterns to consider include:

  • Sequence conservation patterns: Highly conserved residues likely indicate functional importance for ion channel activity.

  • Selection pressure analysis: Calculating dN/dS ratios across CrcB sequences can identify regions under positive or purifying selection.

  • Horizontal gene transfer assessment: Similar to the conjugative transposons identified in B. vulgatus (like PvCTn) , CrcB genes may be subjects of horizontal gene transfer, potentially conferring adaptive advantages.

  • Host-specific adaptations: Compare CrcB variants from Bacteroides species isolated from different host species to identify host-specific adaptations.

Metagenomic studies similar to those conducted for PvCTn-like elements could reveal the prevalence and diversity of CrcB homologs across human populations. This would provide insights into whether CrcB variants are associated with specific host factors or disease states, similar to observations made with other B. vulgatus elements found in approximately 90% of patient samples analyzed .

How do mobile genetic elements impact the distribution and diversity of CrcB homologs in B. vulgatus?

Mobile genetic elements significantly influence the distribution and diversity of CrcB homologs in B. vulgatus populations through several mechanisms:

  • Horizontal gene transfer via conjugative transposons: The research has identified conjugative transposons (CTns) in Bacteroides species, including a novel CTn in P. vulgatus named PvCTn . These mobile elements can facilitate the transfer of genetic material between bacterial strains and species, potentially including CrcB homologs or their regulatory elements.

  • Regulatory cross-talk: The search results indicate that helix-turn-helix motif genes like BVU3433 can regulate conjugation efficiency and gene expression of mobile elements . Similar regulatory mechanisms may influence CrcB expression if the gene resides within or near mobile genetic elements.

  • Selective pressures: Environmental stressors, particularly H₂O₂ exposure, have been shown to decrease expression of regulatory genes like BVU3433 and increase conjugation efficiency . This suggests that stress conditions may enhance the mobility of genetic elements carrying CrcB homologs.

  • Integration site preferences: If CrcB homologs are carried on mobile elements, their distribution would be influenced by integration site preferences of those elements. The search results mention attL and attR sites associated with PvCTn-like elements .

Metagenomic analysis has revealed that approximately 5-14% of Bacteroidota cells encode certain mobile element-associated genes (like BVU3433 homologs) . Similar analyses focused specifically on CrcB homologs could reveal patterns of distribution and diversity across human populations. Researchers studying CrcB diversity should consider both vertical inheritance patterns and potential horizontal gene transfer events when interpreting phylogenetic analyses.

What are the major challenges in generating knockout or mutant strains of B. vulgatus for CrcB homolog functional studies?

Generating knockout or mutant strains of B. vulgatus for CrcB homolog functional studies presents several technical challenges that require specialized approaches:

  • Genetic transformation barriers: B. vulgatus, like other Bacteroides species, has restriction-modification systems that can degrade foreign DNA. Researchers should consider:

    • Methylation of plasmid DNA prior to transformation

    • Using plasmids derived from Bacteroides shuttle vectors

    • Conjugation-based DNA transfer rather than direct transformation

  • Allelic exchange requirements: The search results demonstrate successful generation of deletion mutants in P. vulgatus using allelic exchange vectors . This approach requires:

    • Counter-selectable markers (e.g., tdk system mentioned in the search results)

    • Homologous recombination regions flanking the target gene

    • Selection strategies for both merodiploid formation and resolution

  • Anaerobic growth requirements: All genetic manipulations must be performed under strict anaerobic conditions, requiring specialized equipment and expertise.

  • Confirmation strategies: Successful mutants should be verified through:

    • PCR verification of the deletion

    • Whole genome sequencing to confirm no off-target mutations

    • Complementation studies to verify phenotypes are due to the specific deletion

The search results describe a successful approach using pExchange vectors for generating clean deletions in Bacteroides species . This methodology involves transforming constructs into E. coli S-17, followed by conjugation into B. vulgatus and selection for recombinants. Researchers should consider implementing similar strategies for CrcB homolog studies, with appropriate modifications for gene-specific requirements.

How can transcriptomic and proteomic approaches enhance our understanding of CrcB homolog regulation?

Integrating transcriptomic and proteomic approaches provides comprehensive insights into CrcB homolog regulation in B. vulgatus:

  • RNA-Seq analysis: The search results describe RNA-Seq approaches that successfully identified differential gene expression patterns in B. vulgatus under various conditions . For CrcB research, similar approaches can:

    • Identify co-regulated genes that may functionally interact with CrcB

    • Characterize expression changes under different environmental stressors

    • Map operon structures and potential regulatory elements

  • Quantitative proteomics: Complement transcriptomic data with:

    • SILAC or TMT-based quantitative proteomics to measure protein abundance changes

    • Phosphoproteomics to identify post-translational modifications affecting regulation

    • Membrane-enriched proteomics to specifically analyze the membrane proteome

  • Integration strategies:

    • Correlation analysis between transcript and protein levels

    • Network analysis to identify regulatory hubs

    • Temporal studies tracking expression changes over time

The search results demonstrate the value of this approach, showing that exposure to H₂O₂ caused significant changes in gene expression in B. vulgatus . Similar stress conditions likely affect CrcB expression. Additionally, examining expression patterns in different host backgrounds (as shown with PvCTn in B. thetaiotaomicron vs. P. vulgatus) can reveal host-specific regulatory mechanisms that might be relevant for CrcB function in different microbiome contexts.

What strategies can address the challenges of expressing and crystallizing membrane proteins like B. vulgatus CrcB homolog?

Addressing the challenges of expressing and crystallizing the B. vulgatus CrcB homolog membrane protein requires specialized strategies:

The search results describe successful cloning and expression approaches for Bacteroides proteins , which can inform strategies for CrcB expression. Particularly relevant is the demonstration that pNBU2-bla-CfxA can be used for complementation constructs in Bacteroides species , potentially providing a platform for expressing CrcB variants for functional and structural studies.

How might CrcB homolog research in B. vulgatus contribute to broader microbiome research?

CrcB homolog research in B. vulgatus has significant potential to advance broader microbiome research through multiple interconnected avenues:

  • Microbiome stability mechanisms: Similar to the study of Bacteroidales-specific antimicrobial proteins (BSAPs) that influence strain dominance , understanding CrcB homolog function may reveal how B. vulgatus adapts to and persists within the gut environment during perturbations such as antibiotic treatment or inflammation.

  • Host-microbe interactions: Fluoride channels like CrcB respond to environmental stressors, potentially including host-derived signals. Characterizing these responses may elucidate communication mechanisms between host and microbiota.

  • Microbial community dynamics: The search results demonstrate that strain communities can change following antibiotic disruption . Understanding how CrcB contributes to fitness could help explain these population dynamics.

  • Therapeutic applications: Knowledge of CrcB function could enable development of targeted approaches to modulate Bacteroides abundance in the gut, potentially addressing dysbiosis in conditions associated with altered Bacteroides populations.

  • Environmental adaptation mechanisms: The search results suggest that stress conditions like H₂O₂ exposure alter gene expression in Bacteroides species . Investigating how CrcB responds to similar stressors may reveal adaptation mechanisms relevant to survival in the dynamic gut environment.

Future studies should examine CrcB expression patterns across patient cohorts similar to the approach used for PvCTn-like elements, which were detected in approximately 90% of patient samples across geographically distinct populations . This would clarify the clinical relevance of CrcB variants in human health and disease.

What emerging technologies might enhance research on B. vulgatus CrcB homolog function and structure?

Several emerging technologies show promise for advancing B. vulgatus CrcB homolog research:

  • Cryo-electron tomography: This technique can visualize membrane proteins in their native cellular environment without purification, potentially revealing CrcB organization and interactions within the bacterial membrane.

  • Single-cell transcriptomics: Applied to heterogeneous B. vulgatus populations, this approach can identify cell-to-cell variability in CrcB expression and correlate it with other cellular parameters.

  • AlphaFold2 and related AI protein structure prediction: These tools can generate increasingly accurate structural models of CrcB homologs, particularly valuable for membrane proteins that are challenging to crystallize.

  • CRISPR interference (CRISPRi) systems adapted for Bacteroides: Development of inducible gene expression modulation tools would enable temporal control of CrcB expression without permanent genetic modifications.

  • Microfluidic organ-on-chip technologies: These platforms can simulate the gut environment more accurately than traditional culture systems, allowing study of CrcB function under physiologically relevant conditions.

  • Native mass spectrometry: Advanced techniques optimized for membrane proteins can determine oligomeric states and identify associated lipids or small molecules without disrupting critical interactions.

  • High-throughput mutagenesis coupled with deep sequencing: Systematic generation of thousands of CrcB variants followed by functional selection can comprehensively map structure-function relationships.

These technologies could be particularly valuable when combined with approaches like the Tn mutagenesis mobilization method (TMMM) described in the search results , which enables observation of gene transfer events relevant to the spread of functional genetic elements like those potentially carrying CrcB homologs.

How might understanding CrcB homolog function contribute to developing new strategies for manipulating Bacteroides populations?

Understanding CrcB homolog function could enable novel approaches for precise manipulation of Bacteroides populations in the gut microbiome:

  • Selective inhibition strategies: If CrcB provides critical fluoride resistance, compounds that selectively block this channel could potentially suppress B. vulgatus growth in conditions where fluoride concentration is elevated, offering a targeted approach for microbiome modulation.

  • Engineered probiotic approaches: The search results describe conjugative transposons in Bacteroides species that can transfer between strains . Similar mechanisms could potentially be harnessed to introduce modified CrcB genes into existing gut populations, altering their fitness in specific environments.

  • Diet-based modulation: Understanding how environmental factors regulate CrcB expression might reveal dietary components that can selectively influence B. vulgatus populations by affecting CrcB function.

  • Strain-specific targeting: The search results indicate strain variability in Bacteroides species following perturbation . If CrcB variants contribute to strain-specific fitness advantages, this knowledge could enable development of approaches that target specific strains rather than entire species.

  • Stress-responsive modulation: The research shows that oxidative stress (H₂O₂) affects gene expression in B. vulgatus . Understanding how CrcB responds to similar stressors could enable development of strategies that leverage natural stress responses to modulate Bacteroides populations.

Importantly, any manipulation strategies should consider the complex community dynamics revealed in the search results, where strain communities can shift following perturbation but often return to pre-perturbation states . This suggests that temporary modulation may be more achievable than permanent changes to established Bacteroides populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.