Recombinant Bacteroides vulgatus UPF0059 membrane protein BVU_2631 (BVU_2631)

Shipped with Ice Packs
In Stock

Description

Introduction to BVU_2631

Bacteroides vulgatus is one of the most abundant and ubiquitous bacterial species found in the human gut microbiota, playing a significant role in human digestive health and immune system regulation . Within this important commensal organism, BVU_2631 encodes a membrane protein belonging to the UPF0059 protein family. The recombinant version of this protein is typically produced with a histidine tag (His-tag) to facilitate purification and experimental applications .

BVU_2631 is also known by its gene name mntP, which suggests its potential function as a putative manganese efflux pump . This connection to manganese homeostasis indicates that the protein may play an important role in metal ion regulation within bacterial cells, which is often crucial for survival in the competitive gut environment. The relationship between metal ion transport and bacterial viability makes proteins like BVU_2631 potentially important targets for both basic research and biotechnological applications.

Recombinant Expression Systems

The recombinant BVU_2631 protein is typically expressed in Escherichia coli expression systems, which provide an efficient platform for producing bacterial proteins in sufficient quantities for research purposes . The recombinant version includes a His-tag, usually at the N-terminus, which serves as a purification handle and may also function as a detection tag in experimental applications.

The expression of the full-length protein (amino acids 1-190) in E. coli demonstrates that this membrane protein can be successfully produced in heterologous expression systems, despite the challenges often associated with membrane protein expression .

Purification and Quality Control

Commercial preparations of recombinant BVU_2631 protein typically achieve greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . This high level of purity is essential for accurate experimental results when using the protein for research applications.

Table 1: Specifications of Recombinant BVU_2631 Protein

ParameterSpecification
Source OrganismBacteroides vulgatus
Expression SystemE. coli
Protein LengthFull Length (1-190 amino acids)
TagHis-tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
UniProt IDA6L3M0
Gene NamemntP, BVU_2631
SynonymPutative manganese efflux pump MntP

Reconstitution Protocol

For experimental use, the lyophilized protein should be reconstituted following specific guidelines. According to product specifications, the protein vial should be briefly centrifuged prior to opening to bring the contents to the bottom . The protein should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

For long-term storage after reconstitution, adding glycerol to a final concentration of 5-50% is recommended, with 50% being the standard recommendation for most applications . The reconstituted protein should be aliquoted to avoid repeated freeze-thaw cycles, as these can damage protein structure and reduce activity.

Stability Considerations

Repeated freezing and thawing is not recommended for recombinant BVU_2631, as this can lead to protein degradation and loss of function . Working aliquots can be stored at 4°C for up to one week to minimize the need for repeated freezing and thawing of the stock solution .

Membrane Biology

As a membrane protein, BVU_2631 contributes to the complex architecture of the bacterial cell membrane. Membrane proteins often serve as channels, transporters, receptors, or structural components that maintain membrane integrity. The specific membrane localization of BVU_2631 suggests it may interact with other membrane components to perform its biological functions .

Functional Characterization

The availability of purified recombinant BVU_2631 enables functional studies to investigate its proposed role as a manganese efflux pump. Researchers can conduct in vitro assays to measure metal ion transport, membrane integration, and interactions with potential binding partners or substrates.

Antibody Development

Recombinant proteins like BVU_2631 are commonly used as antigens for antibody production. The resulting antibodies can serve as valuable tools for detecting the native protein in bacterial samples, localizing it within cells using immunofluorescence techniques, or quantifying expression levels using Western blotting or ELISA methods .

UPF0059 Protein Family

BVU_2631 belongs to the UPF0059 protein family, a group of uncharacterized proteins found primarily in bacteria. While detailed functional information on this specific family is limited in the provided search results, the classification provides a framework for comparative analyses with similar proteins from other bacterial species.

Other Bacteroides vulgatus Proteins

Table 2: Comparison Between BVU_2631 and Related Proteins

FeatureBVU_2631BVU2987
ClassificationUPF0059 membrane proteinBacterial periplasmic protein
Potential FunctionPutative manganese efflux pumpPossible inhibitory function
Cellular LocationMembranePeriplasm
Protein Length190 amino acidsNot specified in search results
Structure DeterminationNot mentioned in search resultsCrystal structure determined

Functional Validation

Experimental validation of BVU_2631's proposed function as a manganese efflux pump would significantly enhance our understanding of its biological role. Transport assays, metal binding studies, and genetic manipulation approaches in Bacteroides vulgatus could help confirm and characterize its role in manganese homeostasis.

Role in Host-Microbe Interactions

Given the importance of Bacteroides vulgatus in the human gut microbiome, investigating how BVU_2631 contributes to bacterial colonization, survival, and interaction with host cells represents an important avenue for future research. Such studies could reveal potential connections to human health and disease.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; BVU_2631; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)
Target Names
mntP
Target Protein Sequence
MTTLEIWLLAISLAMDCFTVSITSGIIMRRICWRTFFIMAFFFGLFQAVMPLIGWFAASR FSHLIEDYDHWIAFGLLAFWGGRMIKESFSNEDKRCFDPTKLKVVVTLAIATSIDALAIG ISFAFVGINSFTSILSPIVIIGFTSFVISTLGSLIGVFCGKRFNLRMELWGGLVLIIIGV KILIEHLFLS
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the BVU_2631 protein and why is it significant for research?

BVU_2631 is a membrane protein belonging to the UPF0059 family found in Bacteroides vulgatus, a common commensal bacterium in the human gut microbiome. This protein is significant for research due to its potential role in bacterial membrane function and possible involvement in host-microbe interactions. B. vulgatus is associated with various health effects including protection against inflammatory diseases and modulation of metabolic parameters . Understanding membrane proteins like BVU_2631 can provide insights into the mechanisms underlying these effects and their potential applications in treating inflammatory and metabolic disorders.

What expression systems are recommended for recombinant BVU_2631 production?

For recombinant membrane proteins like BVU_2631, E. coli expression systems with tunable expression capabilities are highly recommended. The Lemo21(DE3) protein production strain is particularly suitable as it is designed for tunable T7 expression to achieve optimal assembly of transmembrane proteins . This strain expresses a T7 RNA polymerase inhibitor protein (LysY) that allows precise regulation of target gene transcription levels . This controlled expression is critical for membrane proteins, as moderate expression levels often result in more functional protein by avoiding saturation of the membrane protein biogenesis pathway, which could otherwise lead to protein aggregation, misfolding, cell death, or inclusion body formation .

How can I confirm successful expression of recombinant BVU_2631?

Confirmation of successful expression should employ multiple techniques:

  • Western blot analysis: Use antibodies specific to BVU_2631 or to an epitope tag incorporated into the recombinant protein.

  • Functional assays: Design assays based on predicted protein function or homology to proteins with known activities.

  • Subcellular localization: Confirm proper membrane insertion using membrane fraction isolation followed by detection methods.

  • Mass spectrometry: For definitive identification and characterization of the expressed protein.

Researchers should maintain appropriate positive and negative controls throughout these confirmation processes to validate results .

What are the key considerations for purifying BVU_2631 after expression?

Given the hydrophobic nature of membrane proteins like BVU_2631, several considerations are critical for successful purification:

  • Detergent selection: Choose detergents that effectively solubilize the protein while maintaining its native structure. A detergent screening approach is recommended to identify optimal conditions.

  • Buffer optimization: Develop buffers that stabilize the protein during purification processes.

  • Purification strategy: Typically involves affinity chromatography (if a tag is incorporated), followed by size exclusion chromatography.

  • Quality control: Employ techniques such as circular dichroism, dynamic light scattering, and activity assays to confirm proper folding and functionality of the purified protein.

It's worth noting that for membrane proteins, less expression often results in more functional protein, so expression conditions should be optimized for quality rather than quantity .

How does BVU_2631 compare structurally and functionally to other UPF0059 family proteins?

While specific structural data on BVU_2631 is limited, comparative analysis with other UPF0059 family proteins reveals several insights:

FeatureBVU_2631Other UPF0059 Family ProteinsNotes
Transmembrane domainsMultiple predictedCommon featureEssential for membrane integration
Conserved motifsUPF0059-specific signaturesPresent across familyMay indicate functional importance
Predicted secondary structureα-helical regionsSimilar patternTypical for membrane proteins
Post-translational modificationsUnder investigationVaries by organismMay affect protein function
Functional domainsNot fully characterizedVaries by specific proteinResearch gap

Further structural studies using X-ray crystallography or cryo-electron microscopy would be valuable for elucidating the specific structure-function relationships of BVU_2631 and its potential interactions with other bacterial or host proteins.

What strain-specific variations exist in BVU_2631 expression and function across different B. vulgatus isolates?

Research indicates significant strain-specific variations among B. vulgatus isolates that may extend to BVU_2631 expression and function:

Different B. vulgatus strains demonstrate varying effects on inflammatory diseases, with some strains like FTJS7K1 showing protective effects against intestinal inflammation while others may promote inflammatory responses . These differences likely relate to variations in protein expression profiles, including membrane proteins like BVU_2631.

Strains such as B. vulgatus FTJS7K1 can modulate gut microbial community composition, increasing beneficial bacteria like Lactobacillus, Akkermansia, and Bifidobacterium while decreasing potential inflammatory bacteria . The role of BVU_2631 in these interactions represents an important area for further investigation.

Genomic analysis of different B. vulgatus strains may reveal polymorphisms in the BVU_2631 gene that could affect protein function. Researchers should consider these strain-specific variations when selecting B. vulgatus isolates for BVU_2631 studies .

How might post-translational modifications affect BVU_2631 structure and function?

Post-translational modifications (PTMs) can significantly impact membrane protein structure and function. For BVU_2631, potential PTMs include:

  • Phosphorylation: May regulate protein activity or interactions with other bacterial proteins

  • Glycosylation: Could affect protein stability and interactions with host factors

  • Lipid modifications: May influence membrane localization and protein-lipid interactions

To investigate PTMs in BVU_2631:

  • Use mass spectrometry-based approaches to identify PTMs

  • Generate site-directed mutants to assess the functional importance of modified residues

  • Compare PTM patterns across different growth conditions and B. vulgatus strains

  • Correlate PTM profiles with functional outcomes in host-microbe interaction studies

These investigations would provide valuable insights into the regulatory mechanisms affecting BVU_2631 function in different physiological contexts.

What role might BVU_2631 play in the metabolic and anti-inflammatory effects observed with B. vulgatus?

Several B. vulgatus strains demonstrate metabolic and anti-inflammatory effects that could potentially involve membrane proteins like BVU_2631:

B. vulgatus Bv46 shows the ability to ameliorate lipid metabolic disorders through mechanisms involving bile salt hydrolase activity and alterations in endogenous metabolites . B. vulgatus FTJS7K1 demonstrates protective effects against LPS-induced intestinal injury and inflammation by modulating cytokine expression and regulatory T cell proportions .

As a membrane protein, BVU_2631 might participate in:

  • Transport processes: Facilitating movement of metabolites across the bacterial membrane

  • Signal transduction: Mediating responses to environmental cues

  • Host-microbe interactions: Participating in adhesion or communication with host cells

  • Maintenance of membrane integrity: Contributing to bacterial survival under stress conditions

Research approaches to elucidate these potential functions should include gene knockout studies, protein-protein interaction analyses, and metabolomic profiling of wild-type versus BVU_2631 mutant strains.

What are the optimal experimental designs for studying BVU_2631 function?

When designing experiments to study BVU_2631 function, researchers should follow these key steps:

  • Define clear variables:

    • Independent variable: BVU_2631 expression levels or mutations

    • Dependent variables: Membrane integrity, transport activity, host response, etc.

    • Control for extraneous variables: Growth conditions, bacterial strain background, host factors

  • Develop specific, testable hypotheses based on predicted functions of BVU_2631 from bioinformatic analyses and existing literature on similar proteins .

  • Design appropriate experimental treatments:

    • Gene knockout/knockdown studies

    • Site-directed mutagenesis of key residues

    • Controlled expression using inducible promoters

    • Heterologous expression in different bacterial hosts

  • Plan measurement approaches for dependent variables using multiple complementary techniques to provide robust evidence .

  • Include appropriate controls:

    • Wild-type bacteria (positive control)

    • Knockout strains complemented with functional BVU_2631

    • Strains expressing non-functional mutants

This systematic approach ensures that experiments generate meaningful data on BVU_2631 function while minimizing experimental bias.

How can I optimize recombinant BVU_2631 expression to maintain protein functionality?

Optimizing recombinant BVU_2631 expression requires careful consideration of several factors:

FactorRecommendationRationale
Expression hostLemo21(DE3) E. coli strainAllows precise tuning of expression levels
Induction conditionsLow inducer concentrationsPrevents protein aggregation and toxicity
TemperatureReduced temperature (16-25°C)Slows expression rate, improves folding
Media compositionSupplemented with membrane componentsSupports proper membrane protein insertion
Expression timeExtended induction periodsAllows gradual accumulation of properly folded protein

Critical insight: For membrane proteins like BVU_2631, "less expression often results in more functional protein" by avoiding saturation of the membrane protein biogenesis pathway . Researchers should aim for quality over quantity, optimizing conditions to maximize the proportion of correctly folded, functional protein rather than total protein yield.

What are the best approaches for investigating BVU_2631 interactions with host factors?

Investigating BVU_2631 interactions with host factors requires multifaceted approaches:

  • In vitro interaction studies:

    • Pull-down assays using purified BVU_2631 and host proteins/fractions

    • Surface plasmon resonance to measure binding kinetics

    • ELISA-based interaction assays

    • Crosslinking followed by mass spectrometry identification

  • Cell culture models:

    • Transfection of epithelial cell lines with BVU_2631

    • Co-culture of BVU_2631-expressing bacteria with host cells

    • Analysis of host cell responses (cytokine production, signaling pathway activation)

  • Ex vivo studies:

    • Intestinal organoid models exposed to purified BVU_2631 or BVU_2631-expressing bacteria

    • Analysis of tissue-specific responses

  • In vivo approaches:

    • Colonization of gnotobiotic mice with wild-type versus BVU_2631 mutant B. vulgatus

    • Analysis of metabolic and inflammatory parameters

These approaches should be conducted in a stepwise manner, beginning with in vitro studies and progressing to more complex models as specific interactions are identified.

How can I resolve technical challenges in studying BVU_2631 membrane integration?

Membrane integration studies for proteins like BVU_2631 present several technical challenges that can be addressed through specialized approaches:

  • Challenge: Determining transmembrane topology
    Solution: Combine computational prediction with experimental validation using protease accessibility assays, reporter fusion approaches, and substituted cysteine accessibility method (SCAM)

  • Challenge: Assessing membrane insertion efficiency
    Solution: Develop fluorescence-based reporters that indicate successful membrane insertion versus aggregation

  • Challenge: Visualizing membrane localization
    Solution: Use super-resolution microscopy techniques with fluorescently tagged BVU_2631 variants

  • Challenge: Measuring stability within the membrane
    Solution: Employ pulse-chase experiments combined with detergent extraction assays

  • Challenge: Determining lipid interactions
    Solution: Use lipidomic approaches and artificial membrane systems with varying lipid compositions

For each approach, researchers should develop quantitative metrics to allow objective comparison between experimental conditions, such as different expression systems or BVU_2631 variants.

How should I present complex data on BVU_2631 expression and function?

Effective presentation of BVU_2631 research data should follow these principles:

  • Keep it simple: Select the most pertinent data that directly addresses your research questions, avoiding overwhelming readers with excessive information .

  • Follow a logical structure: Begin with response rates and participant description (for animal or clinical studies), followed by key findings and relevant statistical analyses .

  • Choose appropriate presentation formats:

    • Use text for simple comparisons and key points

    • Use tables for complex numerical data and comparisons

    • Use graphics for trends, patterns, and relationships

    • Never repeat the same information in multiple formats

  • Present methods accurately: Clearly describe experimental procedures in the methods section, not in the results .

  • Use past tense when describing results .

For BVU_2631 studies specifically, consider creating visual models of membrane topology alongside expression data to help readers conceptualize the protein's structure-function relationships.

How can I reconcile contradictory findings in BVU_2631 research?

Contradictory findings in research are common, especially with complex biological systems. When encountering inconsistent results regarding BVU_2631:

  • Consider strain-specific variations: Different B. vulgatus strains demonstrate varying effects on host physiology. For example, some studies show B. vulgatus protects against colitis while others associate it with inflammatory bowel disease severity . These differences may extend to BVU_2631 function.

  • Examine methodological differences:

    • Expression systems used

    • Purification methods

    • Functional assay conditions

    • Host models (cell lines, animal species)

    • Experimental time frames

  • Integrate multiple data types:

    • Structural data

    • Functional assays

    • Expression profiles

    • Interaction studies

  • Consider context-dependent effects: BVU_2631 may function differently depending on:

    • Microbiome composition

    • Host genetic background

    • Environmental conditions

    • Disease state

When presenting contradictory findings, researchers should explicitly address these potential sources of variation and propose testable hypotheses to resolve the contradictions.

What statistical approaches are most appropriate for analyzing BVU_2631 expression data?

Selecting appropriate statistical methods for BVU_2631 expression data depends on the experimental design and data characteristics:

Data TypeRecommended Statistical ApproachNotes
Comparing expression levels between conditionsStudent's t-test (two conditions) or ANOVA with post-hoc tests (multiple conditions)Verify normality assumptions
Non-normally distributed dataNon-parametric tests (Mann-Whitney U, Kruskal-Wallis)More robust for skewed distributions
Correlation between expression and functional parametersPearson's or Spearman's correlation coefficientChoose based on linearity and normality
Time-course expression dataRepeated measures ANOVA or mixed-effects modelsAccounts for non-independence of repeated measurements
Multi-factorial designsFactorial ANOVA or general linear modelsAllows testing of interaction effects

For all analyses:

  • Report effect sizes alongside p-values

  • Use appropriate corrections for multiple comparisons

  • Validate statistical assumptions

  • Consider biological significance beyond statistical significance

Sample size estimation should be performed prior to experiments to ensure adequate statistical power to detect meaningful differences in BVU_2631 expression or function.

How can I integrate BVU_2631 research findings with broader microbiome data?

Integrating BVU_2631 research with broader microbiome data requires sophisticated approaches:

  • Correlation analysis:

    • Correlate BVU_2631 expression levels with abundance of other microbial species

    • Identify microbial community structures associated with altered BVU_2631 function

    • Example finding: B. vulgatus FTJS7K1 administration increases abundance of beneficial bacteria like Lactobacillus, Akkermansia, and Bifidobacterium

  • Multi-omics integration:

    • Combine proteomics data on BVU_2631 with:

      • Metagenomics (community composition)

      • Metatranscriptomics (gene expression)

      • Metabolomics (metabolite profiles)

    • Example approach: B. vulgatus Bv46 significantly alters endogenous metabolites as revealed by UHPLC-MS/MS analysis

  • Network analysis:

    • Construct interaction networks connecting BVU_2631 to:

      • Other bacterial proteins

      • Host factors

      • Metabolic pathways

    • Identify hub nodes and potential regulatory mechanisms

  • Functional validation:

    • Test predicted interactions using gnotobiotic models

    • Compare wild-type versus BVU_2631 mutant effects on microbiome composition

    • Assess metabolic consequences of BVU_2631 modulation

This integrated approach places BVU_2631 research within its broader ecological and physiological context, providing deeper insights into its role in microbiome-host interactions.

What are the key unanswered questions about BVU_2631 function?

Several critical questions about BVU_2631 remain unanswered and represent important areas for future research:

  • Structural characterization: What is the three-dimensional structure of BVU_2631 and how does it relate to function?

  • Physiological role: What is the native function of BVU_2631 in B. vulgatus physiology?

  • Host interactions: Does BVU_2631 directly interact with host factors, and if so, which ones?

  • Strain variations: How do genetic variations in BVU_2631 across B. vulgatus strains affect protein function and host responses?

  • Regulatory mechanisms: How is BVU_2631 expression regulated in response to environmental conditions?

  • Therapeutic potential: Could modulation of BVU_2631 function be leveraged for therapeutic applications in inflammatory or metabolic diseases?

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular microbiology, immunology, and systems biology.

How might high-throughput approaches advance BVU_2631 research?

High-throughput approaches offer significant potential to accelerate research on BVU_2631:

  • Mutational scanning:

    • Create libraries of BVU_2631 variants through random or site-directed mutagenesis

    • Screen for effects on protein stability, membrane integration, and function

    • Identify critical residues and domains

  • Interactome mapping:

    • Yeast two-hybrid or bacterial two-hybrid screens

    • Protein microarrays with purified BVU_2631

    • Mass spectrometry-based identification of interaction partners

  • Phenotypic screening:

    • Generate large collections of B. vulgatus strains with varied BVU_2631 expression

    • Screen for phenotypic effects in diverse host models

    • Correlate genetic variations with functional outcomes

  • Computational approaches:

    • Molecular dynamics simulations of BVU_2631 in membrane environments

    • Machine learning models predicting functional effects of mutations

    • Systems biology modeling of BVU_2631's role in bacterial physiology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.