Recombinant Balaenoptera borealis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Balaenoptera borealis (Sei whale) (Pollack whale)
Target Names
Target Protein Sequence
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEVNNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSDLKPGELRLLEVDNRVILPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLEIFEKWSASML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes collaborate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, comprised of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its function in cellular respiration?

MT-CO2, also known as COII, COXII, or COX2, belongs to the cytochrome c oxidase subunit 2 family. It functions as a component of the respiratory chain that catalyzes the reduction process in cellular respiration . This protein is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for ATP production during cellular respiration . In the final stage of bacterial respiration, this enzyme catalyzes the oxidation of cytochrome c while reducing oxygen to form water, serving as a vital part of the electron transport chain .

Where is MT-CO2 expressed in cells, and how is it detected experimentally?

MT-CO2 is expressed in mitochondria as part of the oxidative phosphorylation complex. Detection methods include Western blot, immunoprecipitation, immunohistochemistry, immunofluorescence, and flow cytometry . According to validated experimental data, MT-CO2 can be detected in multiple human cell lines including HepG2, 143B.TK.P0, 143B, HeLa, U-251, A549, and MDA-MB-231 cells . The protein typically appears at a molecular weight of 23-26 kDa in SDS-PAGE analysis, slightly below its calculated molecular weight of 26 kDa .

Detection MethodValidated SamplesRecommended Dilution
Western Blot (WB)HepG2, 143B.TK.P0, 143B, HeLa, U-251, A549, MDA-MB-231 cells1:5000-1:50000
Immunoprecipitation (IP)HeLa cells0.5-4.0 μg for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)Human ovarian cancer, human stomach cancer tissue1:500-1:2000
Immunofluorescence (IF/ICC)HepG2 cells1:200-1:800
Flow Cytometry (FC)HeLa cells0.25 μg per 10^6 cells

How should researchers design oxidase assays to study MT-CO2 function?

The oxidase test is a biochemical reaction that assays for the presence of cytochrome oxidase by detecting electron transfer activity. When designing oxidase assays for MT-CO2 research, implement a protocol that utilizes p-aminodimethylaniline oxalate with α-naphthol to detect oxidase activity . The assay functions based on the principle that in the presence of cytochrome oxidase enzyme, reduced colorless reagent becomes an oxidized colored product .

The mechanism involves:

  • Transfer of electrons from cytochrome c to the cytochrome oxidase enzyme

  • Creation of electron-poor cytochrome c molecules and an electron-rich cytochrome oxidase enzyme

  • Transfer of four electrons to molecular oxygen along with four protons to form two water molecules

  • Visualization through electron-rich TMPD (tetramethyl-p-phenylenediamine) molecules passing electrons to electron-poor cytochrome c, resulting in visible blue color

For quantitative analysis, spectrophotometric measurements at appropriate wavelengths can track this reaction kinetically.

What controls should be included when working with recombinant Balaenoptera borealis MT-CO2?

When working with recombinant Balaenoptera borealis MT-CO2, include:

  • Positive controls: Use commercially available cytochrome c oxidase or validated MT-CO2 samples from HeLa or HepG2 cell lines .

  • Negative controls:

    • Heat-inactivated enzymes

    • Samples treated with cytochrome oxidase inhibitors

    • Samples from cell lines with knocked-down MT-CO2 expression

  • Species-specific controls: When studying cross-species interactions, include cytochrome c oxidase subunit 2 from other species to assess conservation and functional differences.

  • Activity validation: Monitor enzyme activity using the oxidase test described above, comparing your recombinant protein against native enzyme preparations.

How does MT-CO2 sequence variation impact oxidative phosphorylation efficiency?

Sequence variation in MT-CO2 can significantly impact oxidative phosphorylation efficiency due to its critical role in electron transfer. Studies on the marine copepod Tigriopus californicus revealed extensive intraspecific nucleotide and amino acid variation in COII sequences across populations . While intrapopulation divergence was minimal, interpopulation divergence at the COII locus reached nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions .

This variation suggests potential adaptations to different environmental conditions. Given the high degree of interaction between MT-CO2 and nuclear-encoded subunits of COX and cytochrome c, some codons in the COII gene are likely under positive selection to compensate for amino acid substitutions in other subunits . Researchers investigating oxidative phosphorylation efficiency should:

  • Sequence MT-CO2 from their research specimens

  • Identify nonsynonymous mutations that may affect functional domains

  • Conduct comparative enzymatic assays to correlate sequence variation with electron transfer efficiency

  • Perform in silico modeling to predict structural changes from amino acid substitutions

What are the challenges in expressing functional recombinant MT-CO2 in heterologous systems?

Expressing functional recombinant MT-CO2 in heterologous systems presents several challenges:

  • Post-translational modifications: MT-CO2 requires specific modifications for proper function that may be lacking in heterologous expression systems.

  • Membrane integration: As a mitochondrial membrane protein, MT-CO2 requires proper insertion into membranes, which can be difficult to achieve in non-native systems.

  • Assembly with other subunits: MT-CO2 functions as part of a multi-subunit complex, requiring co-expression of partner proteins for proper folding and activity .

  • Cofactor incorporation: Ensuring proper incorporation of metal ions and other cofactors necessary for electron transport function.

To address these challenges, researchers should:

  • Consider using mitochondria-targeted expression systems

  • Co-express assembly factors known to facilitate cytochrome c oxidase complex formation

  • Optimize buffer conditions to maintain protein stability

  • Validate functional activity through electron transfer assays

How do researchers analyze evolutionary pressures on MT-CO2 across species?

Analysis methods include:

  • Sequence alignment and phylogenetic analysis: Comparing MT-CO2 sequences across diverse species to identify conserved and variable regions.

  • Codon-based selection tests: Calculating dN/dS ratios to determine if specific codons are under positive selection.

  • Structural mapping: Identifying where variable amino acids locate within the protein structure to assess potential functional impacts.

  • Co-evolution analysis: Examining coordinated evolutionary changes between MT-CO2 and interacting proteins like nuclear-encoded cytochrome c.

Studies of marine copepod Tigriopus californicus suggest that positive selection may drive MT-CO2 evolution to maintain optimal interactions with nuclear-encoded proteins despite genetic divergence between populations .

What insights can MT-CO2 from Balaenoptera borealis provide for marine mammal adaptation to deep-diving?

MT-CO2 from Balaenoptera borealis (sei whale) may provide valuable insights into marine mammal adaptations to deep-diving conditions. As a component of the respiratory chain, MT-CO2 plays a crucial role in oxygen utilization efficiency, which is particularly important for marine mammals during extended deep dives.

Research approaches should include:

  • Comparative sequence analysis: Compare MT-CO2 sequences from deep-diving whale species (including Balaenoptera borealis) with shallow-diving marine mammals and terrestrial relatives.

  • Functional assays under pressure: Test recombinant Balaenoptera borealis MT-CO2 activity under various pressure conditions mimicking deep-diving environments.

  • Oxygen affinity studies: Determine if whale MT-CO2 exhibits enhanced oxygen utilization efficiency at lower oxygen concentrations.

  • Temperature adaptation analysis: Assess whether sei whale MT-CO2 maintains optimal activity at the lower temperatures encountered in deep ocean environments.

These studies could reveal specific amino acid substitutions that enhance mitochondrial function under the extreme conditions experienced during deep dives.

What are the optimal conditions for storing and handling recombinant Balaenoptera borealis MT-CO2?

Optimal storage and handling of recombinant Balaenoptera borealis MT-CO2 is critical for maintaining protein integrity and activity. Based on general protocols for similar proteins, the following conditions are recommended:

  • Storage buffer: PBS with 0.02% sodium azide and 50% glycerol at pH 7.3

  • Storage temperature: -20°C for long-term stability

  • Aliquoting: For -20°C storage, aliquoting may be unnecessary, though it is generally recommended to minimize freeze-thaw cycles

  • Working concentration: Determine optimal concentration through titration in each specific testing system

  • Additives: Small amounts (0.1%) of BSA may help stabilize the protein in dilute solutions

The protein should remain stable for one year after shipment when stored properly . Always avoid repeated freeze-thaw cycles, which can lead to protein denaturation and loss of activity.

How can researchers troubleshoot inconsistent results when using recombinant MT-CO2 in experimental systems?

When troubleshooting inconsistent results with recombinant MT-CO2:

  • Verify protein integrity:

    • Run SDS-PAGE to confirm the expected molecular weight (23-26 kDa)

    • Perform Western blot with anti-MT-CO2 antibodies to confirm identity

    • Assess purity through silver staining

  • Validate activity:

    • Conduct oxidase activity assays as described in section 2.1

    • Compare activity with fresh and stored samples to assess stability

  • Check experimental conditions:

    • Ensure optimal pH (typically near physiological)

    • Verify buffer compatibility with enzyme activity

    • Control temperature during reactions

    • Assess potential interfering substances in your reaction system

  • Technical considerations:

    • Validate antibody specificity when performing immunological techniques

    • Use freshly prepared samples for activity assays

    • Include positive controls from commercial sources

    • Consider batch-to-batch variation in recombinant protein preparations

How might CRISPR-Cas9 technologies enhance our understanding of MT-CO2 function?

CRISPR-Cas9 technologies offer powerful approaches to study MT-CO2 function despite the challenges of targeting mitochondrial DNA where MT-CO2 is encoded. Researchers can:

  • Generate nuclear-encoded MT-CO2 variants: Create cell lines expressing engineered nuclear-encoded MT-CO2 versions targeted to mitochondria, which can then be modified using standard CRISPR-Cas9 techniques.

  • Manipulate interacting partners: Target nuclear-encoded proteins that interact with MT-CO2 to understand their contributions to complex assembly and function.

  • Create tissue-specific knockdowns: Generate conditional knockdown models of MT-CO2 assembly factors to assess tissue-specific requirements.

  • Engineer base editors: Develop mitochondrially-targeted base editors to introduce specific mutations in MT-CO2 and assess their functional consequences.

  • High-throughput functional screens: Create libraries of MT-CO2 variants to identify critical residues for function, assembly, and interaction with other proteins.

These approaches will help elucidate MT-CO2's role in respiratory complex assembly, mitochondrial disease mechanisms, and evolutionary adaptations in different species.

What are the implications of MT-CO2 research for understanding mitochondrial diseases?

MT-CO2 research has significant implications for understanding mitochondrial diseases:

  • Disease mechanism insights: Since cytochrome c oxidase is essential for oxidative phosphorylation, understanding MT-CO2 function helps explain energy production defects in mitochondrial diseases.

  • Biomarker development: MT-CO2 variants or expression levels could serve as biomarkers for mitochondrial dysfunction in various diseases.

  • Therapeutic target identification: Assembly factors and interacting proteins of MT-CO2 may represent targets for therapeutic interventions in mitochondrial cytopathies.

  • Environmental interactions: MT-CO2 research provides insights into how environmental factors affect mitochondrial function, potentially explaining variable disease presentation.

  • Evolutionary medicine: The high variation observed in MT-CO2 across populations of some species suggests that human MT-CO2 variants might contribute to individual differences in disease susceptibility and treatment response.

Future research should focus on characterizing MT-CO2 variants in human populations, their functional consequences, and potential compensatory mechanisms that might be exploited therapeutically.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.