Recombinant Balaenoptera musculus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Balaenoptera musculus Cytochrome c oxidase subunit 2 (MT-CO2)

Recombinant Balaenoptera musculus Cytochrome c oxidase subunit 2 (MT-CO2) refers to a genetically engineered version of the cytochrome c oxidase subunit 2 protein, derived from the blue whale (Balaenoptera musculus). This protein is a crucial component of the mitochondrial electron transport chain, playing a pivotal role in oxidative phosphorylation, which is essential for ATP production in cells.

Function and Importance of Cytochrome c Oxidase Subunit 2

Cytochrome c oxidase subunit 2 is encoded by the mitochondrial DNA and is a key part of the cytochrome c oxidase complex, the final enzyme in the electron transport chain. This complex is responsible for transferring electrons from cytochrome c to oxygen, resulting in the production of ATP, which is vital for cellular energy . The recombinant form of this protein allows for its production in large quantities for research and potential therapeutic applications.

Preparation and Suppliers

Recombinant Balaenoptera musculus Cytochrome c oxidase subunit 2 (MT-CO2) can be prepared through recombinant DNA technology, where the gene encoding the protein is inserted into a suitable expression vector and expressed in a host organism. Suppliers like CUSABIO TECHNOLOGY LLC offer recombinant proteins for research purposes .

SupplierContact InformationCountryProduct ListAdvantage
CUSABIO TECHNOLOGY LLC027-87196173, cusabio@163.comChina3304458

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Balaenoptera musculus (Blue whale)
Target Names
Target Protein Sequence
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEVNNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSDLKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLEFFEKWSASML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This complex plays a crucial role in oxidative phosphorylation. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC uses four electrons from cytochrome c and four protons from the matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MT-CO2 in blue whales?

Answer: Cytochrome c oxidase subunit 2 (MT-CO2) in Balaenoptera musculus (blue whale) is a highly conserved protein encoded by the mitochondrial genome. The full-length protein consists of 227 amino acids and functions as an integral component of the respiratory chain. MT-CO2 is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for the production of ATP during cellular respiration . The protein contains transmembrane domains and is vital for the catalytic activity of the cytochrome c oxidase complex (Complex IV), which represents the terminal complex in the electron transport chain. In blue whales, this protein is particularly important for energy production needed for long-distance migration, deep diving, and maintaining metabolic functions in their large body mass.

How does blue whale MT-CO2 differ from MT-CO2 in other cetaceans and mammals?

Answer: Blue whale MT-CO2 shows both conservation and divergence compared to other species. When comparing the amino acid sequences:

SpeciesSequence Identity with B. musculusKey Differences
Pig (Sus scrofa)~85%Variations primarily in the transmembrane regions
Somali grass rat (Arvicanthis somalicus)~76%Different residues in electron transfer domains
Other baleen whales (e.g., fin whale)>95%Minor substitutions in non-catalytic regions

The high sequence conservation among cetaceans reflects the essential nature of this protein, though subtle differences exist that may relate to diving capacity and metabolic adaptation. Comparative analyses have shown that MT-CO2 sequences can be used for species identification and phylogenetic studies within the cetacean lineage, with interpopulation divergence reaching nearly 20% at the nucleotide level in some marine species .

What are the optimal conditions for expressing recombinant blue whale MT-CO2 in E. coli?

Answer: For optimal expression of recombinant Balaenoptera musculus MT-CO2 in E. coli:

  • Vector Selection: Use expression vectors with strong promoters (T7) and His-tag for purification

  • E. coli Strain: BL21(DE3) or Rosetta strains are preferred for membrane protein expression

  • Culture Conditions:

    • Temperature: Initial growth at 37°C until OD600 reaches 0.6-0.8

    • Induction: Lower temperature to 16-20°C before adding IPTG (0.1-0.5 mM)

    • Duration: Extended expression period (16-24 hours) at lower temperature

  • Buffer Composition:

    • Lysis: Tris/PBS-based buffer (pH 8.0) with protease inhibitors

    • Purification: Include 6% trehalose as a stabilizing agent

    • Storage: 50% glycerol for long-term storage at -20°C/-80°C

The recombinant protein is typically expressed in a lyophilized powder form and requires reconstitution in deionized water to a concentration of 0.1-1.0 mg/mL before use .

How can researchers verify the functionality of recombinant MT-CO2 after expression and purification?

Answer: To verify functionality of recombinant blue whale MT-CO2:

  • Structural Integrity Assessment:

    • SDS-PAGE to confirm molecular weight (>90% purity recommended)

    • Circular dichroism spectroscopy to verify secondary structure elements

  • Functional Assays:

    • Electron transfer activity: Measure using reduced cytochrome c as substrate

    • Spectroscopic analysis: Reduced minus oxidized difference spectra should display characteristic features of cytochrome oxidase

    • Heme binding capacity: Assess d-heme absorbance at 631 nm

  • Interaction Studies:

    • Reconstitution with other COX subunits in lipid bilayer membranes

    • Direct cyclic voltage-current responses on modified electrodes

  • Advanced Validation:

    • Resonance Raman spectroscopy to confirm proper folding and heme incorporation

    • Oxygen consumption measurements to evaluate catalytic efficiency

Both structural and functional parameters should be compared with native MT-CO2 extracted from cetacean tissue samples when available .

How can MT-CO2 be used in evolutionary studies of cetaceans?

Answer: MT-CO2 serves as a powerful tool for evolutionary studies of cetaceans through:

  • Phylogenetic Analysis:

    • MT-CO2 sequences can resolve taxonomic relationships within Mysticeti (baleen whales)

    • The gene shows appropriate evolutionary rate for differentiating species and subspecies

  • Population Genetics:

    • Nucleotide and amino acid variations can be used to differentiate populations

    • Interpopulation divergence can reach ~20% at the nucleotide level

  • Selection Pressure Analysis:

    • Ratio of nonsynonymous to synonymous substitutions (ω) reveals evolutionary constraints

    • Most codons show strong purifying selection (ω << 1)

    • Approximately 4% of sites evolve under relaxed selective constraint (ω = 1)

  • Hybridization Detection:

    • MT-CO2 can help identify positive selection within specific clades

    • Particular sites may experience positive selection related to functional and fitness consequences in interpopulation hybrids

Recent genomic studies have proposed new Northern Hemisphere subspecies designations for blue whales (Balaenoptera musculus musculus in North Atlantic and Balaenoptera musculus sulfureus in North Pacific) based partly on mitochondrial genetic markers, including MT-CO2 .

What methodologies are used to analyze the thermal sensitivity of MT-CO2 in marine mammals?

Answer: Analyzing thermal sensitivity of MT-CO2 in marine mammals employs several complementary approaches:

  • Temperature-Controlled Enzyme Kinetics:

    • Measure MT-CO2 activity across temperature gradients (1°C to 37°C)

    • Calculate Q10 values (rate change per 10°C) to quantify thermal sensitivity

    • Compare with whole mitochondrial respiration rates at identical temperatures

  • KCN Titration Studies:

    • Use potassium cyanide (KCN) to inhibit cytochrome c oxidase activity

    • Perform titrations at multiple temperatures (e.g., 1°C, 6°C, 12°C, 18°C)

    • Determine threshold concentrations where respiratory function decreases

  • Structural Analysis:

    • Employ circular dichroism spectroscopy to track temperature-induced conformational changes

    • Measure thermal denaturation profiles to determine protein stability

  • Comparative Functional Assessment:

    • Compare thermal responses between shallow and deep-diving marine mammals

    • Evaluate correlation between habitat temperature range and enzyme thermal sensitivity

Research has shown MT-CO2 in Arctic charr has excess catalytic capacity compared to mitochondrial state 3 respiration, with mitochondrial oxygen consumption reaching only ~12% of maximum cytochrome c oxidase capacity across temperatures .

What are the main challenges in obtaining high-quality recombinant MT-CO2 and how can they be overcome?

Answer: Major challenges and solutions for high-quality recombinant blue whale MT-CO2 production:

ChallengeSolution
Membrane protein solubilityUse specialized E. coli strains (C41/C43); include mild detergents (0.1-0.5% DDM or CHAPS) in extraction buffers
Proper foldingExpress at lower temperatures (16-20°C); co-express with chaperones; add heme precursors to media
Heme incorporationSupplement growth media with δ-aminolevulinic acid (50-100 μg/mL); add iron sources to facilitate heme synthesis
Protein aggregationInclude stabilizing agents (6% trehalose, glycerol); optimize purification workflow to minimize time
Limited source materialUse synthesized gene optimized for E. coli codon usage rather than native sequence
Enzymatic activity lossPurify in the presence of substrate analogs; maintain reducing environment during purification

Researchers should carefully monitor protein quality using multiple methods including SDS-PAGE, Western blotting, and spectroscopic analysis throughout the purification process .

How can researchers address data inconsistency when comparing recombinant MT-CO2 with native protein in functional studies?

Answer: To address data inconsistency between recombinant and native MT-CO2:

  • Standardize Experimental Conditions:

    • Use identical buffer compositions, pH, temperature, and substrate concentrations

    • Employ the same detection methods and instrumentation across experiments

  • Account for Post-translational Modifications:

    • Validate presence/absence of PTMs in both protein sources

    • Consider in vitro modification of recombinant protein if necessary

    • Document differences in phosphorylation or other modifications

  • Assess Structural Differences:

    • Compare secondary and tertiary structure through circular dichroism and fluorescence spectroscopy

    • Evaluate differences in thermal stability profiles between native and recombinant forms

  • Lipid Environment Considerations:

    • Reconstitute recombinant protein in lipid environments mimicking native membranes

    • Test multiple lipid compositions to find optimal functional conditions

    • Use self-assembled lipid-bilayer-modified electrodes for direct measurements

  • Statistical Approach:

    • Implement Bland-Altman plots to visualize systematic differences

    • Use paired experimental designs to account for batch-to-batch variations

    • Apply correction factors based on calibration curves when appropriate

Resonance Raman studies and photoreduction analyses can help distinguish functional differences, as these techniques have successfully identified separate pools of cytochrome a and a3 in partially reduced cytochrome c oxidase .

How can MT-CO2 be used in non-invasive conservation monitoring of blue whale populations?

Answer: MT-CO2 provides valuable tools for non-invasive blue whale conservation monitoring:

  • Environmental DNA (eDNA) Analysis:

    • Design MT-CO2-specific primers for amplification from seawater samples

    • Develop qPCR assays to estimate relative abundance in different ocean regions

    • Use metabarcoding approaches to simultaneously detect multiple cetacean species

  • Blow Sample Collection:

    • Collect exhaled breath condensate using unoccupied aerial systems (UAS/drones)

    • Extract DNA from blow samples with minimal disturbance to animals (87% of UAS deployments show no detectable behavioral response)

    • Amplify MT-CO2 fragments to identify species and potentially individuals

  • Fecal Sample Analysis:

    • Develop optimized DNA extraction protocols from fecal material

    • Use PCR-based techniques targeting MT-CO2 to identify rhinoceros family members

    • Apply restriction enzyme digestion (e.g., HindIII) to differentiate closely related species

  • Population Structure Assessment:

    • Analyze MT-CO2 sequence variations to differentiate populations

    • Identify unique haplotypes that can define management units

    • Track migration patterns based on genetic signatures

These non-invasive techniques are particularly valuable for endangered blue whale populations by avoiding the stress associated with traditional biopsy sampling while providing critical data for conservation management .

What insights does MT-CO2 provide about blue whale adaptation to climate change?

Answer: MT-CO2 provides several important insights into blue whale adaptation to climate change:

Understanding MT-CO2 function across temperature gradients provides a mechanistic link between molecular adaptation and whole-organism response to climate change.

What statistical approaches are most appropriate for analyzing MT-CO2 sequence variation across cetacean populations?

Answer: For analyzing MT-CO2 sequence variation across cetacean populations:

  • Population Genetic Statistics:

    • FST values to quantify population differentiation

    • Analysis of Molecular Variance (AMOVA) to partition genetic variation

    • Tajima's D and Fu's FS to test for demographic changes or selection

  • Phylogenetic Methods:

    • Maximum Likelihood (ML) with appropriate evolutionary models selected using Akaike Information Criterion (AIC)

    • Bayesian inference methods using MrBayes with proper model selection

    • MCMC-based approaches with multiple chains (three "cold" and one "heated")

  • Selection Analysis:

    • Site-specific selection models to identify codons under selection

    • Branch-site models to detect lineage-specific positive selection

    • McDonald-Kreitman tests to compare polymorphism and divergence

  • Network Analysis:

    • Haplotype networks to visualize relationships between sequences

    • Median-joining networks for complex evolutionary histories

  • Spatial Analysis:

    • Landscape/seascape genetics approaches to correlate genetic patterns with geography

    • Isolation-by-distance testing using Mantel tests

    • Genetic clustering algorithms (STRUCTURE, BAPS)

For robust analysis, researchers should implement multiple approaches, as exemplified in cetacean studies where Bayesian analyses corroborated odontocete monophyly and resolved branching events within Mysticeti .

How should researchers interpret contradictory results between MT-CO2 and nuclear markers in phylogenetic studies?

Answer: When faced with contradictory results between MT-CO2 and nuclear markers:

  • Biological Explanations:

    • Incomplete Lineage Sorting: Recent or rapid divergence may result in conflicting gene trees

    • Introgression/Hybridization: MT-CO2 (maternally inherited) may show different patterns than nuclear genes due to sex-biased dispersal or hybridization

    • Selection Pressures: MT-CO2 may be under different selective constraints than nuclear markers

    • Effective Population Size Differences: Mitochondrial markers have approximately 1/4 the effective population size of nuclear markers

  • Methodological Approach:

    • Implement Bayesian concordance analysis (BCA) to quantify the level of agreement among different genes

    • Construct separate phylogenies for mitochondrial and nuclear datasets

    • Use coalescent-based species tree methods (e.g., *BEAST, ASTRAL) that account for gene tree discordance

    • Weight analyses based on evolutionary rates and information content

  • Integrative Analysis:

    • Apply concatenation methods cautiously, being aware of their limitations

    • Consider likelihood mapping to assess phylogenetic signal strength

    • Implement sensitivity analyses using different outgroups and model parameters

  • Interpretation Framework:

    • Recognize that different markers tell different parts of evolutionary history

    • Look for areas of agreement between markers before focusing on differences

    • Consider the biological context of the species studied

Research on delphinid cetaceans found discordance between mtDNA and individual nuclear DNA loci, but concatenated matrices recovered completely resolved and robustly supported phylogenies that were broadly congruent with Bayesian concordance analysis trees .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.