Recombinant Balaenoptera musculus NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant MT-ND3 refers to the Balaenoptera musculus (blue whale) NADH dehydrogenase subunit 3 protein synthesized using recombinant DNA technology. It is a hydrophobic transmembrane protein critical for the catalytic activity of mitochondrial complex I (NADH:ubiquinone oxidoreductase), which transfers electrons from NADH to ubiquinone while pumping protons across the mitochondrial inner membrane .

Expression and Purification

  • Produced in E. coli with an N-terminal His-tag for affinity chromatography .

  • Lyophilized for long-term storage, reconstituted in Tris/PBS buffer with glycerol .

Research Applications

  • Antibody Production: Used as an immunogen for generating polyclonal antibodies (e.g., ab204977) .

  • Enzyme Activity Studies: Investigates complex I dysfunction in mitochondrial diseases .

  • Structural Biology: Supports crystallography or cryo-EM studies of respiratory chain complexes .

Clinical and Pathogenic Relevance

  • Disease Associations: Mutations in MT-ND3 are linked to mitochondrial disorders such as Leigh syndrome (LS) and Leber’s hereditary optic neuropathy (LHON) . For example, the A47T substitution (10197G>A mutation) disrupts complex I assembly and reduces catalytic activity by ~70% .

  • Therapeutic Target: Recombinant ND3 enables functional rescue studies in cell models of mitochondrial disease .

Research Challenges

  • Species-Specific Data: Most structural and functional data derive from human or B. physalus homologs .

  • Instability: Requires strict storage protocols (-80°C) to prevent aggregation .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Balaenoptera musculus (Blue whale)
Target Names
Target Protein Sequence
MNLLLTLLTNTTLALLLVFIAFWLPQLNVYAEKTSPYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWAIQSNNLNTMLTMALFLISLLAASLAYEWTQEGLEWAE
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It plays a crucial role in catalyzing electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.