Recombinant Balaenoptera physalus ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

The MT-ATP6 protein is a 226-amino acid subunit of the F₀ complex within ATP synthase (Complex V). Key features include:

  • Molecular Weight: ~24.8 kDa .

  • Structure: Transmembrane 4-α-helix bundle critical for proton channel function .

This sequence includes conserved residues essential for proton translocation and ATP synthase assembly .

Research Applications and Findings

Recombinant MT-ATP6 is primarily used to study mitochondrial disorders and ATP synthase mechanics. Key insights include:

Pathogenic Variant Analysis

  • Functional Impact: Mutations like m.8950G>A and m.9025G>A disrupt proton channel function, impairing ATP synthesis by 30–51% in yeast models .

  • Biochemical Markers: Pathogenic variants correlate with reduced ATP synthesis rates, abnormal mitochondrial membrane potential, and altered oligomycin sensitivity .

Disease Modeling

  • Leigh Syndrome: ~20% of cases involve MT-ATP6 mutations, linked to defective Complex V assembly .

  • Optic Neuropathy: The m.8969G>A variant causes LHON-like symptoms, with homoplasmic cell clones showing reduced respiration .

Challenges and Future Directions

  • Heteroplasmy Effects: Variable mutation loads (e.g., 60–93% heteroplasmy) complicate phenotype-genotype correlations .

  • Therapeutic Development: Targeting MT-ATP6 dysfunction could address mitochondrial diseases, but drug delivery to mitochondria remains challenging .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Balaenoptera physalus (Fin whale) (Balaena physalus)
Target Names
Target Protein Sequence
MNENLFAPFMIPVMLGIPITTLIIILPSMLFPAPNRLINNRTIAIQQWLTKLTSKQLMNV HSPKGQTWSLMLISLFLFIASTNLLGMLPHSFTPTTQLSMNVGMAIPLWAGTVTTGFRNK TKMSLAHLLPQGTPTFLIPMLVIIETISLFIQPVAWAVRLTANITAGHLLMHLIGETTLA LMNINLFSAFITFTILALLTILEFAVALIQAYVFTLLVSLYLHDNT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for producing ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Balaenoptera physalus ATP synthase subunit a (MT-ATP6) and what is its significance in research?

ATP synthase subunit a (MT-ATP6) is a mitochondrially-encoded component of the F0 portion of ATP synthase complex (F-ATPase). In Balaenoptera physalus (Finback whale), this protein consists of 226 amino acids and plays a critical role in the proton channel that drives ATP synthesis. The protein is encoded by the MT-ATP6 gene (also known as ATP6, ATPASE6, or MTATP6) in the mitochondrial genome .

The significance of MT-ATP6 in research stems from its essential function in cellular energy production and its involvement in mitochondrial diseases. The strong evolutionary conservation of mitochondrially-encoded proteins like MT-ATP6 across species makes it valuable for comparative studies of mitochondrial function and pathology . Researchers use recombinant versions of this protein to study structure-function relationships, investigate disease-causing mutations, and develop methodologies for mitochondrial genome manipulation.

How do researchers properly store and handle recombinant MT-ATP6 to maintain functionality?

For optimal storage and handling of recombinant MT-ATP6, researchers should follow these evidence-based protocols:

  • Storage Temperature: Store at -20°C for regular use, or at -80°C for extended storage periods .

  • Buffer Composition: The protein is typically supplied in a Tris-based buffer with 50% glycerol, specifically optimized for this protein's stability . Some preparations may use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

  • Avoiding Degradation: Repeated freeze-thaw cycles significantly reduce protein activity. Therefore:

    • Prepare working aliquots and store at 4°C for up to one week

    • For longer storage, maintain aliquots at -20°C or -80°C

  • Reconstitution Protocol:

    • Centrifuge vials briefly before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (typically 50%) before aliquoting for long-term storage

Following these research-validated practices ensures maximum retention of structural integrity and functional activity of the recombinant protein for experimental applications.

What expression systems are most effective for producing functional recombinant MT-ATP6?

The expression of mitochondrially-encoded membrane proteins like MT-ATP6 presents significant challenges due to their hydrophobicity and the differences between mitochondrial and nuclear genetic codes. Based on current research methodologies, the following approaches have proven most effective:

Bacterial Expression Systems:
E. coli remains the most commonly utilized system, as demonstrated in the production of Hylobates lar ATP synthase subunit a with an N-terminal His tag . Key considerations for successful expression include:

  • Use of specialized E. coli strains optimized for membrane protein expression

  • Incorporation of solubility-enhancing fusion tags (His tags being particularly effective)

  • Lower induction temperatures (16-20°C) to reduce inclusion body formation

  • Expression vector selection with appropriate promoters for controlled expression levels

Alternative Expression Systems:
For studies requiring post-translational modifications or when bacterial expression yields non-functional protein:

  • Yeast systems (particularly Saccharomyces cerevisiae) have been successfully employed to study MT-ATP6 variants

  • Insect cell systems using baculovirus vectors can improve folding of complex membrane proteins

Success Metrics:
Regardless of the expression system, validation of correctly folded and functional MT-ATP6 should include:

  • Verification of ATP synthase activity in reconstituted systems

  • Proper membrane integration assessment

  • Structural analysis via limited proteolysis or spectroscopic methods

The choice of expression system should be guided by the specific experimental requirements and downstream applications of the recombinant protein.

How can researchers effectively study mutations in MT-ATP6 using model systems?

Studying mutations in MT-ATP6 presents unique challenges due to mitochondrial heteroplasmy and the difficulty in manipulating the mitochondrial genome. Several model systems have demonstrated effectiveness in such studies:

Yeast Models:
Saccharomyces cerevisiae offers particular advantages for MT-ATP6 mutation studies:

  • Amenability to mitochondrial genetic transformation

  • Inability to stably maintain heteroplasmy, allowing clear phenotypic assessment

  • Strong evolutionary conservation of mitochondrially-encoded proteins

Methodology for yeast models includes:

  • Introduction of specific mutations in the yeast homolog of MT-ATP6

  • Functional assessment through growth assays on respiratory substrates

  • Measurement of ATP production capacity

  • Analysis of respiratory chain complex assembly

This approach has successfully evaluated the pathogenicity of multiple MT-ATP6 variants (m.8843T>C, m.8950G>A, m.9016A>G, m.9025G>A, m.9029A>G, m.9058A>G, m.9139G>A, m.9160T>C) from patients with neurodegenerative disorders .

Drosophila Heteroplasmic Lines:
Drosophila models allow for the study of heteroplasmic conditions and mitochondrial genome recombination:

  • Introduction of temperature-sensitive mutations in mt:CoI alongside MT-ATP6 variants

  • Selection for recombinant mitochondrial genomes under temperature stress

  • Analysis of recombinant genome structure using PacBio single molecule real-time sequencing

This system has been particularly valuable in demonstrating that recombination can occur between mitochondrial genomes and mapping the functional implications of such recombination events .

Data Table: Comparison of Model Systems for MT-ATP6 Mutation Studies

Model SystemAdvantagesLimitationsKey Applications
S. cerevisiae- Amenable to mtDNA manipulation
- Homoplasmic state
- Clear phenotypes
- Rapid growth
- Differences in respiratory metabolism
- Limited tissue-specific effects
- Pathogenicity assessment
- Structure-function studies
- Rapid screening of variants
Drosophila- Heteroplasmy possible
- Complex multicellular system
- Genetic tools available
- mtDNA recombination observable
- More complex manipulation
- Longer generation time
- Recombination studies
- Transmission dynamics
- Tissue-specific effects
Mammalian cell culture- Human cellular context
- Disease-relevant cell types available
- Challenging mtDNA manipulation
- Background nuclear effects
- Human-specific pathophysiology
- Pharmacological interventions

What mechanisms underlie recombination in mitochondrial genomes and how does this relate to MT-ATP6 function?

Mitochondrial genome recombination, once thought impossible in animals, has significant implications for understanding MT-ATP6 function and evolution. Recent research has elucidated several key mechanisms:

Double Strand Break (DSB) Mediated Recombination:
DSBs are primary initiators of homologous exchange in mitochondrial DNA:

  • Experimental introduction of DSBs using restriction enzymes (like XhoI) can induce recombination between co-resident mitochondrial genomes

  • Natural DSBs may occur secondary to DNA damage or replication fork collapse

  • The proximity of the break points to the sites of exchange suggests a mechanistic link

Replication-Associated Recombination:
Evidence suggests replication pausing can facilitate recombination:

  • Recombination hotspots have been observed near Drosophila mTERF (DmTTF) binding sites where mtDNA replication pauses

  • This suggests that stalled replication forks may promote template switching and recombination

Nature of Recombination Events:
Analysis of recombinant mitochondrial genomes reveals:

  • Exchange of substantial continuous segments (typically >1kb) without interruptions

  • Recombination can occur between genomes with significant sequence divergence (>100 SNPs and >20 indels)

  • The process can create functional chimeric genomes that combine advantageous features from parental genomes

Functional Implications for MT-ATP6:
Recombination involving MT-ATP6 has several consequences:

  • Uncoupling of mutations: Recombination can separate detrimental mutations from advantageous ones, potentially rescuing function

  • Creation of novel variants: Chimeric ATP6 proteins may have altered functional properties

  • Evolutionary significance: Even rare recombination events can prevent the accumulation of deleterious mutations in MT-ATP6

This understanding of mitochondrial recombination provides a framework for studying the evolution and function of MT-ATP6 and has implications for interpretations of mitochondrial disease mutations and their inheritance patterns.

What methods are used to assess the pathogenicity of MT-ATP6 variants in experimental systems?

Determining the pathogenicity of MT-ATP6 variants requires a multi-faceted approach combining genetic, biochemical, and functional assessments. The following methodologies have proven effective in research settings:

Growth Assays in Respiratory-Dependent Conditions:

  • Yeast models expressing MT-ATP6 variants are evaluated for growth on non-fermentable carbon sources (requiring respiratory function)

  • Quantitative growth curves provide objective assessment of respiratory competence

  • This approach successfully identified significant defects in yeast models of human variants m.8950G>A, m.9025G>A, and m.9029A>G

ATP Production Measurements:

  • Direct quantification of ATP synthesis capacity in isolated mitochondria

  • Typically performed using luciferin/luciferase-based assays with different substrates

  • Deficits in ATP production provide strong evidence of pathogenicity

Protein Expression and Assembly Analysis:

  • Blue Native PAGE to assess proper incorporation of MT-ATP6 into ATP synthase complexes

  • Western blotting to quantify protein levels and stability

  • Pulse-chase experiments to measure protein turnover rates

Membrane Potential and Proton Leak Assessments:

  • Fluorescent probes (TMRM, JC-1) to measure mitochondrial membrane potential

  • Oxygen consumption rate measurements to detect proton leak across the inner membrane

  • These parameters specifically reflect MT-ATP6 function in maintaining the proton gradient

Evolutionary Conservation Analysis:

  • Comparing the affected residue across species to determine conservation level

  • Strong conservation suggests functional importance and higher likelihood of pathogenicity

  • This approach leverages the strong evolutionary conservation of mitochondrially-encoded proteins

Data Table: Pathogenicity Assessment of Human MT-ATP6 Variants in Yeast Models

MT-ATP6 VariantGrowth on Respiratory MediaATP ProductionPredicted Pathogenicity
m.8843T>CMinimal effectVery mild deficitLikely benign
m.8950G>ASignificant defectSubstantial deficitLikely pathogenic
m.9016A>GMinimal effectVery mild deficitLikely benign
m.9025G>ASignificant defectSubstantial deficitLikely pathogenic
m.9029A>GSignificant defectSubstantial deficitLikely pathogenic
m.9058A>GMinimal effectVery mild deficitLikely benign
m.9139G>AMinimal effectVery mild deficitLikely benign
m.9160T>CMinimal effectVery mild deficitLikely benign

These combined approaches provide a robust framework for evaluating the functional consequences and potential pathogenicity of MT-ATP6 variants identified in patients with suspected mitochondrial disorders .

How is recombinant MT-ATP6 utilized in studies of mitochondrial diseases?

Recombinant MT-ATP6 serves as a powerful tool in mitochondrial disease research, with applications spanning from basic molecular mechanisms to therapeutic development:

Structural and Functional Studies:

  • Purified recombinant MT-ATP6 enables detailed structural analyses through techniques like X-ray crystallography and cryo-EM

  • Structure-function relationships can be established by introducing specific mutations and measuring effects on ATP synthesis

  • These studies help elucidate how naturally occurring mutations lead to disease phenotypes

Antibody Development and Diagnostic Applications:

  • Recombinant MT-ATP6 serves as an antigen for generating specific antibodies

  • These antibodies enable immunohistochemical studies of patient tissues to assess MT-ATP6 expression and localization

  • ELISA assays using recombinant MT-ATP6 can quantify antibody levels in patient samples for diagnostic applications

Model System Development:

  • Recombinant MT-ATP6 and its variants are used to create cellular and organismal models of mitochondrial diseases

  • These models enable systematic testing of potential therapeutic interventions

  • Yeast models expressing human MT-ATP6 variants have successfully recapitulated biochemical deficits observed in patients

Drug Screening Platforms:

  • Systems incorporating recombinant MT-ATP6 facilitate high-throughput screening of compounds that might overcome functional deficits

  • Compounds that enhance residual ATP synthase activity or bypass energy production defects can be identified

  • Such approaches offer paths toward personalized therapies based on specific MT-ATP6 variants

Biomarker Identification:

  • Comparative studies of wild-type and mutant MT-ATP6 help identify downstream metabolic signatures

  • These signatures can serve as biomarkers for disease progression and treatment response

  • Metabolomic and proteomic analyses of models expressing recombinant MT-ATP6 variants reveal disease-specific patterns

These diverse applications highlight the central role of recombinant MT-ATP6 in advancing our understanding of mitochondrial diseases and developing potential therapeutic strategies.

What are the challenges and solutions in studying mitochondrial heteroplasmy using recombinant MT-ATP6?

Mitochondrial heteroplasmy—the coexistence of wild-type and mutant mtDNA within cells—presents significant challenges for researchers studying MT-ATP6 variants. Several innovative approaches have been developed to address these challenges:

Challenges in Heteroplasmy Studies:

  • Variable Mutation Load: The threshold effect, where symptoms appear only above a certain percentage of mutant mtDNA, complicates interpretation of phenotype-genotype relationships

  • Tissue Specificity: Different tissues show varying levels of heteroplasmy and different thresholds for dysfunction

  • Segregation During Cell Division: Uneven distribution of mitochondria during division can alter heteroplasmy levels

  • Difficulty Maintaining Stable Heteroplasmy: Many model systems tend to resolve to homoplasmy over generations

Methodological Solutions:

  • Selection-Based Approaches:

    • Creating heteroplasmic lines with complementary defects in different mitochondrial genomes

    • Temperature-sensitive mutations can be used to select for or against specific mitochondrial genomes

    • This approach has successfully maintained heteroplasmy in Drosophila lines with MT-ATP6 variants and temperature-sensitive mt:CoI mutations

  • Quantification Techniques:

    • Digital droplet PCR for precise quantification of heteroplasmy levels

    • Next-generation sequencing approaches to characterize heteroplasmic populations

    • Single-cell analysis to understand cellular mosaicism

  • Inducible Recombination Systems:

    • Manipulation of mitochondrial dynamics to influence segregation

    • Engineering heteroplasmic maintenance through balanced selective pressures

    • Experimental evidence from Drosophila shows how competing selective pressures can maintain heteroplasmy over multiple generations

  • Novel Model Systems:

    • Drosophila models have demonstrated that selective pressure can maintain heteroplasmy when one genome has a temperature-sensitive defect and the other has a transmission disadvantage

    • These models have facilitated the isolation and characterization of recombinant mitochondrial genomes with chimeric MT-ATP6 genes

  • Functional Complementation Approaches:

    • Creating systems where wild-type MT-ATP6 complements mutant versions

    • Studying threshold effects by titrating expression levels

Research in Drosophila has demonstrated that recombination can occur between heteroplasmic mitochondrial genomes, with implications for understanding how MT-ATP6 variants might interact in heteroplasmic conditions and how recombination might influence the inheritance and expression of mitochondrial diseases .

How does the study of recombinant MT-ATP6 contribute to understanding evolutionary conservation in mitochondrial function?

The study of recombinant MT-ATP6 provides crucial insights into the evolutionary aspects of mitochondrial function across species, with significant implications for both basic science and clinical applications:

Evolutionary Conservation Patterns:

MT-ATP6 displays remarkable conservation across diverse species, from unicellular organisms to mammals, indicating its essential role in bioenergetics. Specific observations include:

  • Conservation hotspots correspond to functionally critical domains, particularly those involved in proton translocation

  • Trans-membrane domains show higher conservation than matrix-exposed regions

  • Residues at the interface with other ATP synthase subunits demonstrate particularly high conservation

Comparative Functional Studies:

Recombinant MT-ATP6 from different species allows direct comparison of functional properties:

  • Saccharomyces cerevisiae serves as an effective model organism due to the strong evolutionary conservation of mitochondrially-encoded proteins like MT-ATP6

  • Functional complementation experiments using recombinant MT-ATP6 from different species can identify conserved functional domains versus species-specific adaptations

  • Cross-species comparisons have revealed that ATP synthase mechanisms are fundamentally conserved from microbes to mammals, despite 2 billion years of evolutionary separation

Interpretation of Disease Variants:

Evolutionary conservation analysis provides a powerful framework for predicting the pathogenicity of MT-ATP6 variants:

  • Mutations affecting highly conserved residues generally show greater functional impact

  • The yeast model system leverages evolutionary conservation to evaluate human disease variants

  • Conservation patterns help distinguish pathogenic mutations from benign polymorphisms

Table: Evolutionary Conservation of Key Functional Domains in MT-ATP6

Functional DomainConservation LevelSpecies RangeImplications for Mutations
Proton channelExtremely highBacteria to mammalsMutations likely pathogenic
Oligomycin binding siteHighFungi to mammalsMutations may affect drug sensitivity
Rotor interaction surfaceVery highAll eukaryotesCritical for ATP synthesis coupling
Matrix-exposed regionsModerateVariableMutations may have species-specific effects
c-ring interfaceExtremely highAll ATP synthasesEssential for proton translocation

This evolutionary perspective provides a rational basis for predicting the functional impact of novel MT-ATP6 variants and understanding how mitochondrial function has been preserved throughout evolutionary history while adapting to diverse physiological contexts and environmental conditions.

What quality control measures should be implemented when working with recombinant MT-ATP6?

Ensuring the quality and consistency of recombinant MT-ATP6 preparations is critical for reliable research outcomes. A comprehensive quality control protocol should include:

Purity Assessment:

  • SDS-PAGE analysis with Coomassie or silver staining to verify protein purity (>90% purity is typically considered acceptable)

  • Western blotting with specific antibodies to confirm identity

  • Mass spectrometry for definitive identification and detection of modifications or truncations

Functional Validation:

  • ATP synthesis activity assays using reconstituted proteoliposomes

  • Proton translocation measurements to confirm channel functionality

  • Binding assays with known interacting partners from the ATP synthase complex

Structural Integrity:

  • Circular dichroism spectroscopy to assess secondary structure composition

  • Limited proteolysis to evaluate proper folding

  • Thermal stability assays to determine proper protein conformation

Contaminant Testing:

  • Endotoxin testing for preparations intended for immunological studies

  • Nuclease and protease activity assays to detect enzymatic contaminants

  • Host cell protein analysis to quantify residual E. coli proteins

Batch Consistency Verification:

  • Lot-to-lot comparison using standardized functional assays

  • Consistency in post-translational modifications between batches

  • Stability testing under standard storage conditions

Data Documentation Requirements:

  • Complete expression and purification records

  • Results from all quality control tests with acceptance criteria

  • Storage conditions and expiration dating

Implementing these quality control measures ensures that experimental results obtained with recombinant MT-ATP6 are reliable and reproducible, particularly important when studying subtle functional differences between wild-type protein and disease-associated variants.

What are the most effective protocols for reconstituting recombinant MT-ATP6 into functional membrane systems?

Reconstitution of recombinant MT-ATP6 into membrane systems is essential for functional studies, as this hydrophobic protein requires a lipid environment to maintain native conformation and activity. The following protocols have demonstrated effectiveness in research settings:

Liposome Reconstitution:

  • Lipid Selection and Preparation:

    • Use a mixture of phosphatidylcholine, phosphatidylethanolamine, and cardiolipin (4:1:1 ratio) to mimic mitochondrial inner membrane composition

    • Prepare small unilamellar vesicles by sonication or extrusion through polycarbonate filters (100-200 nm pore size)

  • Protein Incorporation Methods:

    • Detergent-mediated incorporation: Solubilize MT-ATP6 in mild detergents (DDM, digitonin) and mix with detergent-destabilized liposomes, followed by detergent removal

    • Direct incorporation: Add MT-ATP6 during liposome formation in the presence of destabilizing agents

  • Detergent Removal Techniques:

    • Bio-Beads SM-2 adsorption (slow removal preserves protein structure)

    • Dialysis against detergent-free buffer (48-72 hours with multiple buffer changes)

    • Gel filtration chromatography for rapid separation

Nanodiscs Assembly:

  • Component Preparation:

    • Purify membrane scaffold proteins (MSPs)

    • Solubilize MT-ATP6 in appropriate detergent

    • Prepare lipid mixture in chloroform, dry under nitrogen, and resuspend in buffer with detergent

  • Assembly Protocol:

    • Mix MT-ATP6, MSPs, and lipids at optimized ratios (typically 1:2:60-120)

    • Incubate at 4°C for 1 hour

    • Add Bio-Beads to remove detergent

    • Purify assembled nanodiscs by size exclusion chromatography

Co-reconstitution with Partner Proteins:
For functional studies, MT-ATP6 often requires other ATP synthase subunits:

  • Co-express or separately purify interacting subunits

  • Combine in appropriate detergent before reconstitution

  • Verify complex formation by Blue Native PAGE before reconstitution

Functional Validation Methods:

  • Proton translocation assays using pH-sensitive fluorescent dyes

  • ATP synthesis measurements using luciferin/luciferase-based assays

  • Membrane potential establishment using potentiometric dyes

These reconstitution methods provide researchers with systems that closely mimic the native environment of MT-ATP6, enabling detailed functional studies of wild-type and mutant proteins in controlled experimental conditions.

What emerging technologies are advancing the study of recombinant MT-ATP6 and mitochondrial genetics?

Several cutting-edge technologies are transforming research on recombinant MT-ATP6 and mitochondrial genetics, opening new avenues for understanding function and disease mechanisms:

CRISPR/Cas9-Based Mitochondrial Genome Editing:

  • Mitochondrially-targeted nucleases allow precise introduction of MT-ATP6 mutations

  • Base editors and prime editors adapted for mitochondrial targeting enable specific nucleotide changes

  • These approaches overcome traditional barriers to manipulating the mitochondrial genome

Single-Molecule Sequencing Technologies:

  • PacBio single molecule real-time sequencing (SMRT) has been successfully used to sequence entire mitochondrial genomes including the challenging AT-rich regions

  • This technology has enabled the definitive characterization of recombinant mitochondrial genomes containing chimeric MT-ATP6 genes

  • Long-read sequencing technologies resolve complex structural variations and heteroplasmy patterns

Cryo-Electron Microscopy Advances:

  • High-resolution structures of the entire ATP synthase complex are now achievable

  • Site-specific incorporation of recombinant MT-ATP6 variants allows structural analysis of disease-causing mutations

  • Time-resolved cryo-EM captures dynamic conformational changes during the catalytic cycle

Organoid and Patient-Derived Models:

  • MT-ATP6 function can now be studied in tissue-specific contexts using organoid technology

  • Patient-derived induced pluripotent stem cells maintain original heteroplasmy patterns

  • Differentiation into affected tissues (neurons, muscle) enables disease-relevant functional studies

In Vivo Mitochondrial Imaging:

  • Genetically-encoded sensors for ATP, calcium, and reactive oxygen species

  • Super-resolution microscopy techniques visualize individual ATP synthase complexes

  • Intravital imaging tracks MT-ATP6 function in living organisms

Computational Approaches:

  • Molecular dynamics simulations predict functional impacts of MT-ATP6 mutations

  • Machine learning algorithms integrate multiple data types to improve pathogenicity predictions

  • Systems biology approaches model mitochondrial network responses to MT-ATP6 dysfunction

These technological advances are accelerating our understanding of MT-ATP6 function and the consequences of its mutations, with significant implications for both basic science and clinical applications in mitochondrial medicine.

How might synthetic biology approaches enhance our understanding of MT-ATP6 function and evolution?

Synthetic biology offers transformative approaches to studying MT-ATP6, allowing researchers to move beyond observational science to engineered systems that test specific hypotheses about function and evolution:

Minimal Mitochondrial Genome Design:

  • Designing synthetic mitochondrial genomes with only essential genes

  • Systematic variation of MT-ATP6 sequence to determine minimal functional requirements

  • Testing evolutionary hypotheses through reconstruction of ancestral MT-ATP6 sequences

Domain Swapping and Chimeric Proteins:

  • Creating chimeric MT-ATP6 proteins that combine domains from different species

  • This approach mimics natural recombination events observed in heteroplasmic Drosophila lines

  • Identifying functional modules through systematic domain exchanges

Orthogonal Translation Systems:

  • Developing mitochondria-specific genetic codes and translation machinery

  • Incorporating non-canonical amino acids into MT-ATP6 for precise functional studies

  • These systems can overcome the challenges of the unique mitochondrial genetic code

Engineered Selection Systems:

  • Creating artificial selection pressures to drive MT-ATP6 evolution in the laboratory

  • Similar to the temperature-sensitive selection system used in Drosophila studies

  • Such systems can reveal adaptation mechanisms and evolutionary constraints

Synthetic Circuits for Controlling Heteroplasmy:

  • Engineered genetic systems that can modulate heteroplasmy levels

  • Controllable recombination systems to study mitochondrial genome dynamics

  • These approaches build upon natural recombination observed between mitochondrial genomes

De Novo Design of ATP Synthase Components:

  • Computational design of alternative MT-ATP6 structures with equivalent function

  • Testing evolutionary contingency versus functional necessity

  • Creating novel proton-translocation mechanisms to understand fundamental principles

Table: Synthetic Biology Applications in MT-ATP6 Research

ApproachTechnical ImplementationResearch Questions Addressed
Ancestral sequence reconstructionComputational prediction and gene synthesisHow has MT-ATP6 evolved across evolutionary history?
Minimal functional unitSystematic mutagenesis and truncationWhat elements of MT-ATP6 are absolutely required for function?
Domain swappingGibson assembly of chimeric genesWhich domains confer species-specific properties?
Non-canonical amino acid incorporationExpanded genetic code in mitochondriaHow do specific chemical groups contribute to proton translocation?
Engineered selection systemsTemperature-sensitive complementationWhat evolutionary trajectories are possible under different selective pressures?
Synthetic heteroplasmy controllersInducible recombination systemsHow do heteroplasmy dynamics influence MT-ATP6 function?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.