Recombinant Balaenoptera physalus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Balaenoptera physalus (Fin whale) (Balaena physalus)
Target Names
Target Protein Sequence
MAYPFQLGFQDAASPIMEELLHFHDHTLMIVFLISSLVLYIITLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEVNNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSDLKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLFYGQCSEICGSNHSFMPIVLELVPLEVFEKWSVSML
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme a of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, comprised of heme a3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of Cytochrome c oxidase subunit 2 in fin whales?

Cytochrome c oxidase subunit 2 (MT-CO2) is a critical component of Complex IV in the mitochondrial respiratory chain of Balaenoptera physalus. As in other mammals, this protein plays an essential role in cellular respiration by facilitating electron transfer from cytochrome c to molecular oxygen. In fin whales, this process is particularly significant given their adaptations for prolonged diving and exposure to varying temperatures. Based on studies of related proteins in the same species, MT-CO2 likely contributes to the specialized oxygen utilization efficiency observed in these marine mammals. Similar to the MT-CO3 subunit, MT-CO2 would be encoded by the mitochondrial genome and function as an integral membrane protein within the cytochrome c oxidase complex .

What are the challenges in producing functional recombinant MT-CO2 protein?

Producing functional recombinant MT-CO2 presents several technical challenges that researchers should anticipate:

  • Membrane protein expression: As an integral membrane protein, MT-CO2 contains hydrophobic domains that can complicate expression in conventional systems. E. coli expression systems (as used for MT-CO3) may yield protein requiring refolding or special solubilization techniques .

  • Post-translational modifications: Mitochondrial proteins often undergo specific post-translational modifications that may not be properly executed in bacterial expression systems, potentially affecting proper folding and function.

  • Cofactor incorporation: Ensuring proper incorporation of metal cofactors essential for electron transport function.

  • Protein stability: Maintaining stability during purification while preserving native-like structure and function often requires optimization of buffer conditions.

Expression SystemAdvantagesLimitationsRecommendations
E. coliHigh yield, economical, rapidLimited post-translational modifications, inclusion body formationUse specialized strains (C41/C43), fusion tags, low-temperature induction
Insect cellsBetter folding, some PTMsHigher cost, longer production timeConsider for functional studies requiring proper folding
Mammalian cellsMost complete PTMs, native-like foldingHighest cost, lowest yieldReserve for studies focusing on protein interactions or function

What expression and purification strategies are most effective for recombinant fin whale MT-CO2?

Based on successful approaches with related proteins such as fin whale MT-CO3, researchers should consider:

  • Expression strategy: Recombinant expression in E. coli using an N-terminal His-tag has proven effective for MT-CO3 from Balaenoptera physalus . For MT-CO2, researchers should similarly consider using bacterial expression systems with affinity tags to facilitate purification.

  • Induction conditions: When expressing membrane proteins, lowering induction temperature (16-20°C) and using lower IPTG concentrations often improves proper folding and reduces inclusion body formation.

  • Purification protocol: A multi-step purification approach is recommended:

    • Initial purification using immobilized metal affinity chromatography (IMAC)

    • Secondary purification via size exclusion chromatography

    • Consider detergent screening to identify optimal solubilization conditions

  • Storage considerations: Following the approaches used for MT-CO3, purified MT-CO2 should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and researchers should avoid repeated freeze-thaw cycles . For long-term storage, adding glycerol to a final concentration of 50% and storing at -80°C is recommended based on protocols established for similar proteins .

How should researchers validate the structural integrity and functionality of purified recombinant MT-CO2?

Multiple complementary approaches should be employed to ensure both structural integrity and functional activity:

Structural validation:

  • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

  • Thermal shift assays to assess protein stability

  • Limited proteolysis to evaluate protein folding

  • Size exclusion chromatography to confirm monodispersity

Functional validation:

  • Cytochrome c oxidation activity assays measuring electron transfer rates

  • Oxygen consumption measurements

  • Spectroscopic analysis of redox transitions

  • Reconstitution into liposomes for membrane protein functionality tests

Researchers should compare results to available data on native cytochrome c oxidase or other recombinant subunits. Particular attention should be paid to temperature-dependent activities, as fin whale proteins show adaptations to function at varying temperatures during deep dives .

What controls are essential when designing experiments with recombinant fin whale MT-CO2?

A robust experimental design requires appropriate controls:

  • Positive controls:

    • Commercially available cytochrome c oxidase from related species

    • Well-characterized subunits from other mammals

  • Negative controls:

    • Denatured MT-CO2 protein

    • MT-CO2 with mutated catalytic sites

  • Expression controls:

    • Empty vector expressions processed identically

    • Expression of non-related proteins using the same system

  • Species-specific controls:

    • When possible, comparison with native fin whale tissue samples

    • Comparison with recombinant MT-CO2 from other cetaceans or mammals

  • Technical controls:

    • Multiple protein batches to assess reproducibility

    • Varying buffer conditions to establish robustness of observations

How can recombinant MT-CO2 be used to study temperature adaptation mechanisms in fin whales?

Fin whales encounter varying water temperatures during deep dives, requiring molecular adaptations in respiratory proteins. Researchers can investigate temperature adaptations in MT-CO2 through:

  • Comparative enzyme kinetics: Measure cytochrome c oxidase activity across temperature ranges (5-37°C) to identify potential cold adaptation mechanisms, similar to studies on fin whale hemoglobin that revealed temperature-dependent functional properties .

  • Thermal stability analysis: Compare the thermal denaturation profiles of fin whale MT-CO2 with those from terrestrial mammals to identify stabilizing adaptations.

  • Structure-function relationships: Identify amino acid substitutions unique to fin whale MT-CO2 that might contribute to cold temperature function, similar to the approach used in analyzing fin whale hemoglobin adaptations .

  • Molecular dynamics simulations: Conduct in silico analysis of protein flexibility and stability at different temperatures based on the primary structure.

The functional properties of fin whale hemoglobin have demonstrated specialized adaptations to temperature changes, and similar adaptations may exist in MT-CO2 . Such studies could reveal parallel evolutionary adaptations across different oxygen-binding proteins in these deep-diving mammals.

What methodological approaches are recommended for studying interactions between MT-CO2 and other respiratory chain components?

Understanding protein-protein interactions within the respiratory chain requires specialized techniques:

  • Co-immunoprecipitation studies: Using antibodies against MT-CO2 to pull down interacting partners.

  • Surface plasmon resonance (SPR): Quantifying binding kinetics between purified MT-CO2 and other respiratory chain components.

  • Chemical cross-linking followed by mass spectrometry: Identifying interaction interfaces between MT-CO2 and binding partners.

  • Reconstitution experiments: Assembling purified components to reconstruct functional respiratory chain complexes and measuring activity restoration.

  • Cryo-electron microscopy: Visualizing assembled complexes to determine structural arrangements.

A systematic approach combining multiple methods is recommended to build a comprehensive understanding of MT-CO2 interactions within the unique context of fin whale respiratory physiology.

How might MT-CO2 contribute to the metabolic adaptations that enable fin whales' prolonged dives?

Fin whales can undertake prolonged dives in cold water, suggesting specialized metabolic adaptations in their respiratory proteins . Researchers investigating MT-CO2's role in these adaptations should consider:

  • Oxygen affinity studies: Analyzing whether fin whale MT-CO2 exhibits modified oxygen binding properties compared to terrestrial mammals.

  • Proton pumping efficiency: Investigating if MT-CO2 shows adaptations for maintaining ATP production under oxygen-limited conditions.

  • Resistance to inhibition: Testing whether fin whale MT-CO2 demonstrates increased resistance to inhibition by factors present during diving (increased CO₂, lactate).

  • Comparative genomics: Analyzing MT-CO2 sequences across shallow and deep-diving cetaceans to identify dive-related adaptations.

Studies on fin whale hemoglobin have shown adaptations to the effects of carbon dioxide and lactate, which are relevant during prolonged dives . Similar regulatory mechanisms might exist in MT-CO2, potentially involving altered interactions with these heterotropic effectors.

What are common experimental pitfalls when working with recombinant MT-CO2, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant MT-CO2:

  • Low expression yields:

    • Solution: Optimize codon usage for expression system

    • Try lower induction temperatures (16-20°C)

    • Consider fusion partners (SUMO, MBP) to enhance solubility

  • Protein aggregation:

    • Solution: Screen detergents systematically (DDM, LDAO, Fos-choline)

    • Add stabilizing agents like glycerol, trehalose (6% as used with MT-CO3)

    • Purify at 4°C and minimize concentration steps

  • Loss of activity:

    • Solution: Supplement buffers with appropriate cofactors

    • Minimize oxidation by including reducing agents

    • Avoid multiple freeze-thaw cycles as recommended for MT-CO3

  • Poor reproducibility:

    • Solution: Standardize expression and purification protocols

    • Characterize each protein batch thoroughly

    • Maintain detailed records of all experimental conditions

How can researchers reconcile contradictory data in functional studies of MT-CO2?

When faced with contradictory results in MT-CO2 studies, researchers should implement a systematic troubleshooting approach:

  • Verify protein quality:

    • Re-assess purity by SDS-PAGE and mass spectrometry

    • Confirm structural integrity through biophysical methods

    • Check for potential contaminants affecting measurements

  • Evaluate experimental conditions:

    • Systematically vary buffer components, pH, salt concentrations

    • Test temperature dependence of observed phenomena

    • Consider effects of different detergents or lipid environments

  • Cross-validate with multiple methods:

    • Apply orthogonal techniques to measure the same parameter

    • Compare in vitro and in silico predictions

    • Collaborate with other laboratories for independent verification

  • Consider biological context:

    • Evaluate if contradictions might reflect actual biological adaptations

    • Compare with data from different cetacean species

    • Relate observations to known diving physiology

What analytical approaches should be used to investigate the evolutionary adaptations in fin whale MT-CO2?

Exploring evolutionary adaptations requires sophisticated analytical approaches:

  • Comparative sequence analysis:

    • Align MT-CO2 sequences across diverse marine and terrestrial mammals

    • Identify positively selected residues through dN/dS analysis

    • Map conservation patterns onto structural models

  • Ancestral sequence reconstruction:

    • Infer ancestral MT-CO2 sequences at key evolutionary nodes

    • Express and characterize ancestral proteins

    • Compare functional properties between ancestral and modern proteins

  • Structure-function correlations:

    • Generate homology models based on known cytochrome c oxidase structures

    • Map fin whale-specific substitutions onto functional domains

    • Perform site-directed mutagenesis to test the impact of specific residues

  • Integration with physiological data:

    • Correlate molecular findings with diving profiles across cetaceans

    • Consider adaptations in the context of fin whale respiratory physiology

    • Examine potential co-evolution with other respiratory proteins

This approach may reveal parallel evolutionary patterns to those observed in fin whale hemoglobin, where specific substitutions (like the A2 Pro→Ala) have been linked to altered interactions with regulatory molecules like 2,3-diphosphoglycerate .

How might studying fin whale MT-CO2 contribute to understanding climate adaptation in marine mammals?

Research on fin whale MT-CO2 has significant implications for understanding climate adaptation:

  • Temperature sensitivity studies:

    • Characterize MT-CO2 function across temperature ranges fin whales experience

    • Identify molecular mechanisms of thermal tolerance

    • Model potential impacts of ocean warming on protein function

  • Oxygen utilization efficiency:

    • Investigate whether MT-CO2 adaptations enhance oxygen use under limited availability

    • Relate these adaptations to changing ocean oxygen levels

    • Compare with species from different thermal environments

  • Carbon dioxide responses:

    • Analyze MT-CO2 sensitivity to elevated CO₂ levels

    • Connect findings to ocean acidification scenarios

    • Build upon known interactions between CO₂ and fin whale hemoglobin

These studies could provide insights into how these large marine mammals might respond physiologically to changing ocean conditions, complementing current research on their ecological roles in carbon cycling .

What novel experimental techniques could advance our understanding of MT-CO2 function in situ?

Emerging technologies offer new opportunities for studying MT-CO2 function:

  • Nanoscale respirometry:

    • Measure oxygen consumption in reconstructed respiratory complexes

    • Analyze function under simulated diving conditions

    • Quantify effects of pressure and temperature simultaneously

  • Cryo-electron tomography:

    • Visualize native mitochondrial membrane architecture

    • Locate MT-CO2 within the respiratory supercomplex

    • Compare structural arrangements across species

  • Single-molecule techniques:

    • Track conformational changes during catalytic cycles

    • Measure electron transfer events in real-time

    • Correlate structure with function at unprecedented resolution

  • In cellulo approaches:

    • Develop cellular models expressing fin whale MT-CO2

    • Use genome editing to create chimeric respiratory complexes

    • Measure cellular responses to simulated diving conditions

TechniqueResolutionInformation GainedTechnical Challenges
Nanoscale respirometryFunctionalReal-time activity, environmental responsesSample preparation, signal-to-noise ratio
Cryo-EM/tomography2-5 ÅStructural organization, protein interactionsSample vitrification, computational analysis
Single-molecule FRET2-10 nmDynamic conformational changesProtein labeling, data interpretation
In cellulo modelsCellularPhysiological relevance, regulatory networksExpression system development, validation

These advanced techniques would complement the fundamental biochemical and biophysical characterizations currently possible with recombinant proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.