Recombinant Banana bunchy top virus Movement and RNA silencing protein (DNA-M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
DNA-M; C4; Movement and RNA silencing protein; MP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Banana bunchy top virus (isolate Autralia) (BBTV)
Target Names
DNA-M
Target Protein Sequence
MALTTERVKLFFEWFLFFGAIFIAITILYILLVLLFEVPRYIKELVRCLVEYLTRRRVWM QRTQLTEATGDVEIGRGIVEDRRDQEPAVIPHVSQVIPSQPNRRDDQGRRGNAGPMF
Uniprot No.

Target Background

Function
This protein facilitates the direct transport of the viral genome to neighboring plant cells through plasmodesmata, without any budding. The movement protein enables efficient cell-to-cell propagation by bypassing the host cell wall barrier. Begomovirus genome is transported out of the nucleus by the Nuclear shuttle protein (NSP), and the movement protein subsequently transports the DNA-NSP complex to cell plasmodesmata, facilitating further movement across the cell wall. This protein also functions as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a plant viral defense mechanism that limits the accumulation of viral RNAs.
Database Links

KEGG: vg:963868

Subcellular Location
Host cell membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of Banana bunchy top virus?

BBTV (genus Babuvirus, family Nanoviridae) possesses a multipartite genome consisting of six circular single-stranded DNA components, designated as DNA-R, DNA-U3, DNA-S, DNA-N, DNA-M, and DNA-C. Each component ranges from 1.0 to 1.1 kb in size and contains specific functional regions including a major common region (CR-M) and a stem-loop common region (CR-SL) . These components collectively encode proteins essential for viral replication, encapsidation, movement, and suppression of host defense mechanisms. The DNA-R encodes the replication initiation protein, while DNA-C encodes the viral coat protein essential for encapsidation and aphid transmission .

How are BBTV isolates phylogenetically classified?

Phylogenetic analysis of BBTV isolates reveals two distinct evolutionary groups: the Pacific-Indian Oceans (PIO) group and the South-East Asian (SEA) group. These classifications are primarily based on nucleotide sequence analysis of all six genomic components, with particular emphasis on the replicase gene. Sequence comparison studies demonstrate that the CR-SL region is highly conserved among all BBTV isolates, while the CR-M region exhibits greater homology within each phylogenetic group . Isolates from India, Sri Lanka, Myanmar, and Fiji typically cluster within the PIO group, while those from Taiwan and other East Asian regions generally belong to the SEA group .

What are the conserved regions in BBTV components, and what is their significance?

Each BBTV genomic component contains two highly conserved regions: the stem-loop common region (CR-SL) and the major common region (CR-M). The CR-SL is exceptionally conserved across all isolates and contains a characteristic stem-loop structure critical for viral replication initiation. The CR-M region shows greater conservation within phylogenetic groups but exhibits variation between the PIO and SEA groups . Additionally, TATA box regions are highly conserved in most components except DNA-4, where the TATA region shows significant diversity between phylogenetic groups . These conserved elements play crucial roles in viral replication, transcription regulation, and potentially in component reassortment during mixed infections.

What is the specific role of DNA-M in BBTV infection cycle?

DNA-M of BBTV encodes the movement protein, which is critical for cell-to-cell movement of the virus within host tissues. This protein facilitates viral transport through plasmodesmata, allowing systemic infection throughout the banana plant. Research indicates that the movement protein interacts with host cellular machinery to modify plasmodesmatal size exclusion limits, thereby enabling the passage of viral DNA-protein complexes between adjacent cells . Additionally, the movement protein may play a role in viral stability within the plant vascular system, potentially enhancing long-distance movement of the virus through the phloem.

How does the DNA-M component interact with other BBTV genomic components?

The DNA-M component functions in coordination with other BBTV genomic components to establish successful infection. While DNA-M encodes the movement protein, evidence suggests potential interaction between this protein and the coat protein (encoded by DNA-C) to form movement-competent viral complexes . Furthermore, research indicates possible functional interactions between the movement protein and RNA silencing suppressors encoded by DNA-3 and DNA-4, creating a coordinated system that facilitates viral spread while simultaneously countering host defense mechanisms. These interactions represent crucial aspects of BBTV pathogenicity and host range determination.

What structural features distinguish the DNA-M component from other BBTV components?

The DNA-M component, while sharing the CR-SL and CR-M regions with other BBTV components, contains unique structural elements associated with its movement protein function. Sequence analysis reveals conserved motifs characteristic of plant virus movement proteins, including potential nucleic acid binding domains and transmembrane regions . Comparative genomic studies have identified specific sequence patterns in the DNA-M intergenic region that may facilitate component-specific replication and expression regulation. Additionally, the movement protein encoded by DNA-M exhibits structural features that enable interactions with host cell membranes and plasmodesmata, distinguishing it from proteins encoded by other BBTV components.

How do BBTV proteins function as RNA silencing suppressors?

BBTV encodes multiple proteins with RNA silencing suppression activity, particularly B3 and B4 proteins (encoded by DNA-3 and DNA-4, respectively). Experimental evidence demonstrates that both proteins can increase transient expression of reporter genes like green fluorescent protein (GFP) and enhance the pathogenicity of heterologous viruses such as potato virus X (PVX) in experimental hosts . B4 exhibits broader suppression capabilities, being able to reverse established gene silencing both locally (on inoculated leaves) and systemically (on upper leaves). In contrast, B3 demonstrates more limited activity, functioning only during infection of inoculated leaves . These proteins likely act at different steps in the RNA silencing pathway, with B4 potentially interfering with the production or activity of mobile silencing signals.

What experimental approaches are used to determine RNA silencing suppressor activity?

RNA silencing suppressor activity is typically assessed through several complementary experimental approaches:

  • Transient expression assays: Potential suppressor proteins are co-expressed with reporter genes (e.g., GFP) in experimental hosts like Nicotiana benthamiana, and the impact on reporter gene expression is quantified.

  • Reversal of established silencing: Pre-silenced plants (such as the 16c transgenic N. benthamiana line with silenced GFP) are used to evaluate a protein's ability to reverse established silencing mechanisms.

  • Pathogenicity enhancement: Candidate suppressor genes are inserted into viral vectors like PVX, and the resulting chimeric viruses are assessed for enhanced symptom severity in infected plants.

  • Molecular characterization: Biochemical assays to identify interactions between suppressor proteins and components of the host RNA silencing machinery (Dicer, RISC complexes, siRNAs, etc.) .

These approaches have confirmed that BBTV B3 and B4 proteins function as RNA silencing suppressors, with B4 showing more robust activity across multiple experimental systems .

What is the mechanistic relationship between viral movement and RNA silencing suppression?

The movement of plant viruses and suppression of RNA silencing are mechanistically interconnected processes. For BBTV, the movement protein (encoded by DNA-M) facilitates cell-to-cell movement, while RNA silencing suppressors (encoded by DNA-3 and DNA-4) counter the host's antiviral RNA silencing response. This coordination is essential because:

  • Viral movement often triggers host surveillance mechanisms, leading to the activation of RNA silencing.

  • The silencing signal can spread systematically ahead of viral infection, creating an immune zone that restricts viral movement.

  • Successful long-distance movement requires the virus to overcome this systemic silencing response.

Research suggests potential functional interactions between these proteins, where suppression of host defense by B3 and B4 proteins creates an environment permissive for movement protein function . This relationship represents a critical determinant of BBTV's ability to establish systemic infection and underscores the evolutionary pressure for viruses to develop both movement and silencing suppression strategies.

What evidence exists for recombination events in BBTV components?

Sequence analysis of BBTV isolates has revealed compelling evidence for recombination events within and between viral components. Particularly noteworthy is the DNA-2 CR-M of a Bihar isolate (FJ605508), which demonstrates significant sequence homology with DNA-6 CR-M, strongly suggesting recombination between these components . Such recombination events likely contribute to BBTV's genetic diversity and evolutionary adaptation. Additionally, comparative genomic analyses indicate potential recombination hotspots within the intergenic regions of several BBTV components, including DNA-M. These events appear more frequent in regions adjacent to the conserved CR-SL and CR-M sequences, suggesting that these structures may facilitate template switching during replication .

How do recombination events affect BBTV evolution and pathogenicity?

Recombination represents a significant driving force in BBTV evolution by:

  • Generating novel genetic combinations that may enhance viral fitness

  • Facilitating adaptation to new host varieties or environmental conditions

  • Potentially enabling the virus to overcome host resistance mechanisms

  • Contributing to the development of geographically distinct strains

Phylogenetic analyses suggest that BBTV genome likely originated from a single component and underwent diversification during evolution, with portions of DNA-3 and DNA-4 remaining relatively conserved . This pattern indicates selective pressure to maintain certain functional domains while allowing others to diversify. Recombination events involving the DNA-M component may be particularly significant for viral adaptation, as alterations to the movement protein could influence host range and tissue tropism, potentially altering pathogenicity profiles.

What methodologies are most effective for detecting recombination in multipartite viral genomes?

Detection of recombination events in multipartite viruses like BBTV requires a multifaceted approach:

  • Complete genomic sequencing: Analysis of all six components from multiple isolates provides the foundation for recombination detection.

  • Sequence alignment and comparative analysis: Detailed alignment of homologous regions across components and isolates can reveal unexpected sequence similarities indicative of recombination.

  • Recombination detection algorithms: Specialized software tools (RDP, GENECONV, BootScan, MaxChi) can identify statistically significant recombination signals.

  • Phylogenetic incongruence analysis: Construction of phylogenetic trees based on different genomic regions can reveal topological inconsistencies suggesting recombination.

  • Breakpoint mapping: Precise identification of recombination junctions helps understand the mechanisms of recombination.

When applied to BBTV, these methods have successfully identified recombination events between different components (such as between DNA-2 and DNA-6) and between isolates from different geographical regions, providing insights into the evolutionary history and ongoing genetic diversification of this virus .

What are the most effective techniques for isolation and molecular characterization of BBTV DNA-M?

Isolation and characterization of BBTV DNA-M involves several specialized techniques:

  • Sample collection and DNA extraction: Leaf samples from infected banana plants showing typical bunchy top symptoms are collected, and total DNA is extracted using the CTAB method or commercial plant DNA isolation kits .

  • Component-specific PCR amplification: DNA-M is selectively amplified using component-specific primers targeting conserved regions, typically generating amplicons of approximately 1.0-1.1 kb .

  • Cloning and sequencing: Amplified DNA-M fragments are cloned into appropriate vectors (such as pGEM-T) and subjected to bidirectional sequencing to obtain complete nucleotide sequences.

  • Bioinformatic analysis: Sequence data is analyzed to identify open reading frames, regulatory elements, and comparative analysis with other BBTV isolates using tools like BLAST, CLUSTAL, and other phylogenetic software.

  • Functional validation: For functional studies, the movement protein gene can be cloned into expression vectors for recombinant protein production or viral vectors for in planta studies .

This methodological pipeline has been successfully employed to characterize DNA-M components from diverse BBTV isolates, providing insights into their genetic organization and evolutionary relationships.

How can recombinant BBTV movement protein be expressed and purified for functional studies?

Expression and purification of recombinant BBTV movement protein typically involves:

  • Expression system selection: The movement protein gene from DNA-M is cloned into appropriate expression vectors (such as pET28a) containing affinity tags (His-tag, GST, etc.).

  • Bacterial expression: Transformed E. coli strains (commonly BL21(DE3) pLysS) are induced with IPTG to express the recombinant protein under optimized conditions (temperature, induction time, media composition) .

  • Protein purification: Affinity chromatography (typically Ni-NTA for His-tagged proteins) is used as the primary purification step, followed by additional techniques like ion-exchange or size-exclusion chromatography to enhance purity.

  • Protein characterization: Purified protein is analyzed by SDS-PAGE, Western blotting, and mass spectrometry to confirm identity and purity .

  • Functional assays: Various biochemical and biophysical techniques (circular dichroism, dynamic light scattering) can be employed to characterize structural properties, while functional assays may include nucleic acid binding studies and cell-to-cell movement assays in plant protoplasts.

These approaches have been successfully applied for BBTV coat protein expression and could be adapted for movement protein studies, although researchers should be aware that membrane-associated proteins like movement proteins often present challenges in bacterial expression systems.

What plant experimental systems are most suitable for studying BBTV movement protein function?

Several experimental systems have proven valuable for studying BBTV movement protein function:

  • Model plant systems: Nicotiana benthamiana serves as an excellent heterologous host for transient expression studies due to its amenability to agroinfiltration and availability of transgenic lines.

  • Protoplast systems: Isolated plant protoplasts can be used for cell-to-cell movement assays, particularly when coupled with fluorescently tagged movement proteins.

  • Microinjection studies: Direct injection of purified movement protein or viral nucleoprotein complexes into plant cells, coupled with fluorescence microscopy, can reveal real-time movement dynamics.

  • Transgenic banana systems: For authentic host studies, transgenic banana plants expressing movement protein variants can provide insights into in vivo function, though these systems are more technically challenging.

  • Heterologous viral vector systems: The movement protein gene can be incorporated into well-characterized plant viral vectors (like PVX or TMV) to assess its function in a viral context .

Each system offers distinct advantages, and a comprehensive understanding of movement protein function typically requires a combination of approaches, ranging from in vitro biochemical studies to in planta functional analyses.

How might recombinant DNA-M movement protein be utilized in developing BBTV-resistant banana varieties?

Recombinant DNA-M movement protein offers several strategic approaches for developing BBTV-resistant banana varieties:

  • Dominant negative mutants: Expression of dysfunctional movement protein variants in transgenic bananas could interfere with wild-type viral movement protein function, inhibiting cell-to-cell movement.

  • RNA silencing approaches: Transgenic expression of hairpin constructs derived from the DNA-M sequence can trigger RNA silencing specifically targeting viral movement protein transcripts, potentially conferring resistance before viral silencing suppressors can counter host defenses .

  • Movement protein-interacting peptides: Identification of host factors that interact with the movement protein could lead to the development of decoy peptides that competitively inhibit these interactions.

  • CRISPR-Cas-based immunity: CRISPR-Cas systems designed to target DNA-M sequences could provide molecular immunity against BBTV infection.

  • Epitope mapping: Characterization of critical epitopes within the movement protein could inform the development of antibody-mediated resistance strategies.

These approaches represent cutting-edge applications of molecular biology to agricultural challenges, with the potential to develop durable resistance against this devastating viral pathogen.

What are the implications of DNA-M variability for diagnostic test development?

The genetic variability observed in DNA-M components across BBTV isolates has significant implications for diagnostic test development:

  • PCR-based diagnostics: Primers must be designed to target highly conserved regions of DNA-M to ensure detection of diverse isolates. Alternatively, multiplex PCR approaches may be necessary to capture the genetic diversity present in field populations.

  • Serological tests: Antibodies raised against recombinant movement protein must recognize conserved epitopes to be broadly applicable across BBTV variants.

  • Loop-mediated isothermal amplification (LAMP): This field-deployable diagnostic technique requires careful primer design accounting for known DNA-M sequence variations.

  • Next-generation sequencing approaches: These offer the most comprehensive detection capability but require sophisticated bioinformatic pipelines to account for genetic diversity.

  • Recombination awareness: Diagnostic tests must consider the potential for recombination events that could affect test sensitivity and specificity .

Effective diagnostic strategies should incorporate comprehensive sequence knowledge of DNA-M variants and regularly validate test performance against emerging isolates to ensure continued diagnostic efficacy.

How does the movement protein of BBTV compare structurally and functionally with movement proteins from other plant virus families?

Comparative analysis of BBTV movement protein with those from other plant virus families reveals important insights:

This comparative approach provides valuable context for understanding the unique aspects of BBTV movement protein function and may inform novel control strategies targeting these virus-specific mechanisms.

What key questions remain unanswered regarding BBTV DNA-M and movement protein function?

Despite significant advances, several critical questions remain regarding BBTV DNA-M and its encoded movement protein:

  • Structural characterization: The three-dimensional structure of the movement protein remains unsolved, limiting our understanding of its functional domains and mechanism of action.

  • Host protein interactions: The specific host factors that interact with the movement protein during cell-to-cell movement are largely unidentified.

  • Movement mechanism: The precise mechanism by which the movement protein facilitates viral transport through plasmodesmata requires further elucidation.

  • Component interactions: How the movement protein potentially interacts with other BBTV-encoded proteins, particularly the coat protein and silencing suppressors, remains poorly understood.

  • Evolution and adaptation: The evolutionary forces driving DNA-M diversification and its role in host adaptation and range expansion require further investigation.

Addressing these questions would significantly advance our understanding of BBTV pathogenesis and potentially reveal new targets for resistance development.

What emerging technologies might accelerate research on BBTV movement protein?

Several cutting-edge technologies hold promise for advancing BBTV movement protein research:

  • Cryo-electron microscopy: This technology could reveal the structural details of the movement protein, particularly in complex with viral DNA or host factors.

  • Single-molecule tracking: Advanced imaging techniques could allow real-time visualization of movement protein function in living plant cells.

  • Protein-protein interaction networks: Techniques like BioID or proximity labeling could identify the complete interactome of the movement protein within plant cells.

  • CRISPR-based approaches: Precise genome editing of host factors could help delineate the host requirements for movement protein function.

  • Synthetic biology approaches: Engineered viral systems with modified movement proteins could provide insights into structure-function relationships.

  • Nanobody technology: Development of movement protein-specific nanobodies could serve as both research tools and potential therapeutic agents.

These technological advances, combined with continued traditional approaches, promise to significantly enhance our understanding of BBTV movement protein biology in the coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.