Recombinant Banna virus Non-structural protein 4 (S11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
Segment-11; S11; Non-structural protein 4; NS4; VP11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Banna virus (strain Indonesia/JKT-6423/1980) (BAV)
Target Names
S11
Target Protein Sequence
MTIQVQNLNCCPGRFVCVHKMTLLIILIISAAVTVIDQLYQKLPYDEQTKYIVSTITDGI NATIISVMAILGLNNLNRVRYSKLDENGVYSQEMVTMNVQSDAANNKKQLKKKENEDVDE EKGLYPNLKLTEPTAPMIHNYMYDHKTQQAYLLTEHQIEQIKQNSVDPNNTPKIEVRSQF
Uniprot No.

Target Background

Database Links

KEGG: vg:995342

Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Banna virus and what role does the Non-structural protein 4 (S11) play in its genome organization?

    Banna virus is a 12-segment, double-stranded RNA virus belonging to the family Reoviridae and genus Seadornavirus . It was first isolated from encephalitis patients in southern China's Yunnan Province, specifically in Xishuangbanna Prefecture, in 1987 . The virus genome consists of 12 segments, with the S11 segment encoding the Non-structural protein 4. While specific functions of BAV NS4 are still being investigated, non-structural proteins in segmented RNA viruses typically play crucial roles in viral replication cycles, including genome replication, host immune evasion, and virion assembly, without being incorporated into the mature virus particle.

  • What molecular techniques are most effective for cloning and expressing recombinant Banna virus NS4 protein?

    For recombinant expression of Banna virus NS4, researchers should consider the following methodological approach:

    Expression SystemAdvantagesDisadvantagesApplications
    E. coliHigh yield, cost-effective, rapidLimited post-translational modificationsAntibody production, initial structural studies
    Insect cellsBetter folding, some post-translational modificationsHigher cost, longer expression timeFunctional studies, protein-protein interactions
    Mammalian cellsNative-like modificationsLowest yield, most expensiveIn-depth functional studies

    When selecting an expression system, it's important to note that no mammalian cell line has been reported to propagate BAV , which may indicate challenges in using mammalian expression systems. Baculovirus-insect cell systems may offer a balance between proper protein folding and reasonable yield for functional studies of NS4.

  • How can researchers verify the correct folding and functionality of recombinant Banna virus NS4?

    Verification of properly folded, functional recombinant NS4 requires multiple complementary approaches:

    • Circular dichroism spectroscopy to assess secondary structure elements

    • Size exclusion chromatography to confirm proper oligomeric state

    • Thermal shift assays to evaluate protein stability

    • Functional assays based on predicted activities (RNA binding, protein-protein interactions)

    • Comparative analysis with other characterized viral non-structural proteins from the Seadornavirus genus

    These approaches should be paired with Western blot confirmation using specific antibodies against NS4, if available, or against epitope tags incorporated into the recombinant construct.

  • What is known about the geographical distribution of Banna virus and how might this affect strain variations in NS4?

    Banna virus has been isolated from mosquitoes in China, Indonesia, and Vietnam, suggesting widespread distribution throughout Southeast Asia . In Vietnam specifically, researchers have demonstrated that "2 new phylogenetically distinct types of BAVs are co-circulating" , indicating significant genetic diversity within BAV populations. This geographical distribution and phylogenetic diversity likely extends to the NS4 protein, which may show strain-specific variations that could affect its function. Comparative sequence analysis of S11 segments from different geographical isolates would be essential to map conservation patterns across NS4 and identify potentially functionally important domains.

  • What approaches are recommended for generating antibodies against Banna virus NS4?

    For antibody production against BAV NS4, researchers should consider:

    • Recombinant full-length protein immunization

    • Synthetic peptide approach targeting predicted antigenic epitopes

    • DNA immunization with S11 segment expressed in vivo

    Each approach should be followed by standard hybridoma generation or phage display technology to isolate specific antibodies. Epitope mapping using truncated constructs can help identify immunodominant regions of NS4, which is particularly valuable given the limited published information on this protein.

Advanced Research Questions

  • How can structural biology approaches be applied to determine the three-dimensional structure of BAV NS4?

    Drawing parallels from successful structural studies of enteroviral REPLRs , several complementary approaches could be employed:

    • X-ray crystallography: Similar to the approach used for coxsackievirus and rhinovirus structures (1.54-2.54 Å resolution)

    • Cryo-electron microscopy: Particularly useful if NS4 forms larger complexes

    • NMR spectroscopy: For characterizing dynamic regions and protein-RNA interactions

    • Computational modeling: Especially homology modeling if structurally similar proteins exist

    The crystal structures of viral RNA elements have revealed "remarkable similarity" despite being "crystallized in different conditions and space groups" , suggesting that similar approaches might successfully elucidate the structure of BAV NS4, potentially revealing conserved functional domains.

  • What role might NS4 play in Banna virus pathogenesis and host specificity?

    Investigation into NS4's role in pathogenesis should consider:

    • BAV has been isolated from encephalitis patients in China, suggesting neurotropism

    • The virus has also been isolated from pigs, cattle, and humans , indicating a broad host range

    • No experimental infection with BAV has resulted in clinical encephalitis in mice

    These observations suggest complex host-specific pathogenicity mechanisms potentially involving NS4. Methodological approaches should include:

    • Reverse genetics to generate NS4 mutants and assess virulence

    • Comparative studies of NS4 interactions with host proteins across different species

    • Assessment of NS4's potential role in interferon antagonism or other immune evasion strategies

  • What are the key challenges in developing a reverse genetics system for studying Banna virus NS4 function?

    Developing a reverse genetics system for BAV faces several methodological challenges:

    • The 12-segment genome structure complicates complete reconstruction

    • Limited available cell culture systems, as "no mammalian cell line has been reported to propagate BAV"

    • Potential requirement for helper viruses or complementing cell lines

    • Need for segment-specific promoter characterization

    A methodological approach might include initial focus on establishing replicon systems for individual segments before attempting full genome reconstruction, similar to approaches used for other segmented RNA viruses.

  • How can Next-Generation Sequencing (NGS) technologies advance the study of Banna virus and NS4 variation?

    NGS approaches offer powerful tools for BAV research:

    NGS ApplicationResearch PurposeMethodological Advantage
    Whole-genome sequencingComplete characterization of field isolatesIdentification of all 12 segments including S11 variation
    MetagenomicsVirus discovery in field samplesDetection without prior sequence knowledge
    TranscriptomicsHost response to infectionUnderstanding NS4's impact on cellular pathways
    Small RNA sequencingAntiviral RNAi responseDetection of NS4-targeted small RNAs

    As noted in the search results, "NGS methods are transforming our capacity to detect pathogens and perform disease diagnosis" . For BAV, these approaches can help track evolutionary changes in NS4 across different geographical locations and host species.

  • What protein-protein interactions might NS4 participate in during the viral replication cycle?

    Investigation of NS4 interactions should focus on three major categories:

    • Interactions with other viral proteins: Particularly other non-structural proteins involved in replication complex formation

    • Interactions with host factors: Including potential interactions with cellular RNA-binding proteins, similar to how enteroviral REPLRs interact with host proteins like PCBP2

    • Interactions with host immune components: Particularly factors involved in innate immune signaling

    Methodological approaches should include co-immunoprecipitation, yeast two-hybrid screening, and proximity labeling techniques such as BioID. The observed interactions between enteroviral RNA structures and host proteins PCBP2 and 3CD provide a model for how such virus-host interactions might be studied for BAV NS4.

  • How does NS4 potentially contribute to viral RNA replication and transcription?

    NS4's role in viral RNA processes could be investigated through:

    • RNA binding assays to assess affinity for viral genome segments

    • In vitro replication assays using purified components

    • Structure-function analyses of putative RNA-binding domains

    This approach parallels studies of enteroviral replication, where researchers identified "highly conserved RNA structures at the extreme 5′ end of their genomes that recruit essential proteins" . Similar conserved structures and protein interactions might exist for BAV, involving NS4.

  • What approaches can be used to investigate the potential role of NS4 in counteracting host antiviral responses?

    Methodological approaches should include:

    • Reporter assays for key immune signaling pathways (IFN, NF-κB)

    • Protein-protein interaction studies with specific immune factors

    • Gene expression profiling in cells expressing NS4 versus controls

    These investigations are particularly relevant given observations from alphasatellite research showing that "plant antiviral defenses silence alphasatellite gene expression at both transcriptional and posttranscriptional levels, generating highly-abundant 21, 22 and 24 nucleotide small interfering RNAs" . Similar host defense mechanisms might target BAV, with NS4 potentially playing a counterdefense role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.