Recombinant Barbarea verna Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Barbarea verna (Early yellowrocket) (Erysimum vernum)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLANKPVDIEVPQTVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPASNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNGRQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant *Barbarea verna* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its role in photosynthesis?

Apocytochrome f, encoded by the petA gene, functions as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. This membrane-bound protein facilitates electron transfer between photosystem II and photosystem I during the light-dependent reactions of photosynthesis. The mature cytochrome f is produced when a heme group is covalently attached to the apocytochrome precursor. In Barbarea verna, as in other photosynthetic organisms, this protein is essential for energy conversion during photosynthesis, functioning specifically in the transfer of electrons from plastoquinol to plastocyanin. Understanding this protein's structure and function provides crucial insights into photosynthetic efficiency and energy production in plants .

What expression systems are typically used for producing Recombinant Barbarea verna Apocytochrome f?

Recombinant Barbarea verna Apocytochrome f is commonly produced using prokaryotic expression systems, with Escherichia coli being the predominant host for initial expression studies. For more complex applications requiring post-translational modifications, researchers often employ eukaryotic expression systems such as yeast (Pichia pastoris or Saccharomyces cerevisiae), insect cells (Sf9 or Sf21 lines with baculovirus vectors), or plant-based expression systems. Each expression system offers distinct advantages: E. coli provides high yield and cost-effectiveness, yeast systems offer proper protein folding, and plant-based systems ensure native post-translational modifications. Selection of the appropriate expression system depends on the specific research objectives, required protein modifications, and downstream applications .

What purification methods yield the highest purity for Recombinant Barbarea verna Apocytochrome f?

Purification of Recombinant Barbarea verna Apocytochrome f typically involves a multi-step process to achieve high purity while maintaining protein activity. Initial purification often begins with affinity chromatography using histidine tags that allow selective binding to nickel or cobalt resins. This is frequently followed by ion-exchange chromatography to separate proteins based on charge differences. Size exclusion chromatography is then employed as a polishing step to remove aggregates and achieve >95% purity. For membrane-associated forms of apocytochrome f, detergent solubilization with mild non-ionic detergents (such as n-dodecyl β-D-maltoside) is typically required prior to chromatographic separation. Researchers should monitor protein purity throughout the process using SDS-PAGE and Western blotting with specific antibodies to confirm identity. Final purity assessment through mass spectrometry is recommended for applications requiring exceptional purity standards .

How can Recombinant Barbarea verna Apocytochrome f be utilized in photosynthesis efficiency research?

Recombinant Barbarea verna Apocytochrome f serves as a valuable tool in photosynthesis efficiency research through multiple experimental approaches. Researchers can incorporate the purified protein into reconstituted membrane systems to study electron transport kinetics under controlled conditions. Site-directed mutagenesis of the recombinant protein allows for systematic analysis of structure-function relationships, particularly regarding electron transfer rates and interaction with other components of the photosynthetic apparatus. The protein can also be used in comparative studies with apocytochrome f from other species to investigate evolutionary adaptations in photosynthetic efficiency. Additionally, researchers utilize the recombinant protein to develop in vitro assay systems for screening compounds that might enhance photosynthetic efficiency or protect against photoinhibition. When designing these experiments, it's crucial to maintain physiologically relevant conditions, including appropriate pH, temperature, and redox environment to ensure findings translate to in vivo systems .

What are the critical considerations for structural studies of Recombinant Barbarea verna Apocytochrome f?

Structural studies of Recombinant Barbarea verna Apocytochrome f require careful attention to protein stability, sample homogeneity, and experimental conditions. For X-ray crystallography, researchers must optimize crystallization conditions through extensive screening of precipitants, buffers, additives, and temperatures. Typically, hanging-drop or sitting-drop vapor diffusion methods yield the best crystals. For cryo-electron microscopy studies, sample vitrification protocols must be optimized to prevent ice formation. In both approaches, researchers should consider using detergent micelles or nanodiscs to stabilize the membrane-associated regions of the protein. For NMR studies, isotope labeling (13C, 15N) is necessary, requiring specialized expression protocols. Researchers should also account for the heme group when analyzing structural data, as its presence significantly impacts the protein's conformation and stability. Combining multiple structural techniques often provides the most comprehensive understanding of this complex protein's structure-function relationships .

How can researchers address experimental challenges when studying interactions between Recombinant Barbarea verna Apocytochrome f and other components of the photosynthetic electron transport chain?

Studying interactions between Recombinant Barbarea verna Apocytochrome f and other photosynthetic components presents several methodological challenges. Researchers should employ multiple complementary approaches to obtain reliable data. Surface plasmon resonance and isothermal titration calorimetry can quantify binding affinities and thermodynamic parameters, while chemical cross-linking coupled with mass spectrometry identifies specific interaction interfaces. For dynamic interaction studies, fluorescence resonance energy transfer (FRET) microscopy with labeled proteins offers temporal resolution of binding events. When investigating the functional significance of these interactions, researchers should develop reconstituted systems that incorporate lipid compositions mimicking the thylakoid membrane environment. A common pitfall is studying these interactions in solution conditions that don't reflect the crowded environment of the thylakoid membrane; therefore, molecular crowding agents should be considered. Additionally, researchers should account for the impact of pH gradients and membrane potential on interaction dynamics, as these factors significantly influence electron transport in vivo .

What are the optimal conditions for measuring the electron transport activity of Recombinant Barbarea verna Apocytochrome f in vitro?

Measuring electron transport activity of Recombinant Barbarea verna Apocytochrome f requires carefully controlled experimental conditions that mimic the native environment while allowing precise measurements. The optimal buffer system typically contains 20-50 mM phosphate or Tricine buffer at pH 7.0-7.5, supplemented with 100-150 mM NaCl to maintain ionic strength. For membrane-associated forms, incorporation into liposomes composed of plant thylakoid lipids (approximately 40% monogalactosyldiacylglycerol, 30% digalactosyldiacylglycerol, 15% sulfoquinovosyldiacylglycerol, and 15% phosphatidylglycerol) most accurately reflects the native environment. Electron donors (such as reduced plastoquinone analogs) and acceptors (such as plastocyanin) should be added at concentrations determined through preliminary kinetics experiments. Oxygen should be controlled either through degassing or precise measurement with oxygen electrodes, as it can accept electrons and confound results. Temperature control at 25°C ± 1°C is essential for reproducible kinetics. Researchers should monitor activity spectrophotometrically, tracking the oxidation/reduction states of donors and acceptors at their characteristic absorption wavelengths. For accurate results, it's crucial to verify that the recombinant protein contains correctly incorporated heme, as the apoprotein will not support electron transport .

What methods can be used to assess the structural integrity of Recombinant Barbarea verna Apocytochrome f?

Assessment of structural integrity for Recombinant Barbarea verna Apocytochrome f requires a multi-technique approach. Circular dichroism spectroscopy in the far-UV range (190-250 nm) provides information about secondary structure content, while near-UV CD (250-350 nm) reports on tertiary structure organization. These measurements should be performed at different temperatures to determine the thermal stability profile. Intrinsic tryptophan fluorescence spectroscopy with excitation at 280 nm can detect subtle conformational changes affecting the microenvironment of aromatic residues. For higher resolution analysis, limited proteolysis coupled with mass spectrometry identifies exposed flexible regions, while hydrogen-deuterium exchange mass spectrometry maps solvent-accessible regions with peptide-level resolution. Researchers should also assess the heme environment through UV-visible absorption spectroscopy, monitoring the characteristic Soret band (~420 nm) and Q-bands (500-600 nm) of the heme group. Changes in these spectral features can indicate alterations in the heme pocket architecture. For membrane-associated forms, additional techniques such as differential scanning calorimetry and fluorescence anisotropy measurements provide information about protein-lipid interactions and rotational mobility .

How can researchers design comparative studies between Barbarea verna Apocytochrome f and homologs from other species?

Designing robust comparative studies between Barbarea verna Apocytochrome f and homologs from other species requires systematic approaches to control for experimental variables. Sequence analysis should begin with multiple sequence alignment using MUSCLE or T-Coffee algorithms, followed by phylogenetic analysis to establish evolutionary relationships. Quantitative comparison of physicochemical properties should include thermal stability profiles (measured by differential scanning fluorimetry), redox potentials (determined by potentiometric titration), and kinetic parameters (kcat, Km values for interaction partners). Structural comparisons should combine homology modeling with available crystallographic data, focusing on conservation of catalytic residues and interaction surfaces. Functional assays must be performed under identical conditions for all homologs, with standardized protein concentrations, buffer compositions, temperature, and detection methods. For in vivo comparative studies, researchers should consider using heterologous expression systems where the native petA gene is replaced with genes from different species, allowing assessment of functional complementation. Data analysis should employ multivariate statistical methods to identify correlations between sequence, structure, and functional properties across species. This approach allows researchers to distinguish conserved features essential for function from species-specific adaptations .

How should researchers interpret redox potential measurements of Recombinant Barbarea verna Apocytochrome f?

Interpretation of redox potential measurements for Recombinant Barbarea verna Apocytochrome f requires careful consideration of multiple factors that influence electron transfer capabilities. The midpoint potential (Em) typically ranges between +300 to +380 mV (vs. standard hydrogen electrode) at physiological pH, but researchers should analyze how this value shifts across the pH range of 6.0-8.0, as proton-coupled electron transfer is common in photosynthetic complexes. Data should be fitted to the Nernst equation, with n (number of electrons transferred) verified experimentally rather than assumed. Temperature dependence studies provide thermodynamic parameters (ΔH°, ΔS°) that offer insights into the nature of the electron transfer process. When comparing with literature values, researchers must account for differences in measurement techniques (spectroelectrochemistry vs. potentiometric titration), reference electrodes, and buffer compositions. Anomalous redox behavior might indicate incomplete heme incorporation, protein misfolding, or modification of key residues near the heme pocket. Researchers should also investigate how the redox potential is modulated by interaction with protein partners or incorporation into membrane environments, as these factors significantly affect function in vivo. Integration of these data with structural information and molecular dynamics simulations can provide a mechanistic understanding of how specific amino acid residues modulate the redox properties .

What statistical approaches are most appropriate for analyzing comparative data between wild-type and mutant forms of Recombinant Barbarea verna Apocytochrome f?

Statistical analysis of comparative data between wild-type and mutant forms of Recombinant Barbarea verna Apocytochrome f should employ both parametric and non-parametric methods depending on data characteristics. For kinetic parameters (kcat, Km) that typically follow normal distributions, paired t-tests or ANOVA with post-hoc tests (such as Tukey's HSD) can identify significant differences between multiple variants. For data sets with potential outliers or non-normal distributions, non-parametric alternatives like the Mann-Whitney U test or Kruskal-Wallis test are more appropriate. Researchers should establish appropriate sample sizes through power analysis before experimentation, typically aiming for statistical power of 0.8 or higher. When analyzing spectroscopic data, principal component analysis can identify subtle spectral differences between variants that might not be obvious from direct comparison. For time-series measurements (such as stability studies), repeated measures ANOVA or mixed-effects models should be employed. Correlation analyses between structural parameters and functional outcomes can reveal structure-function relationships, particularly when multiple mutations are studied. All statistical analyses should include appropriate corrections for multiple comparisons (such as Bonferroni or false discovery rate methods) to minimize Type I errors. Researchers should report effect sizes alongside p-values to indicate the magnitude of differences between variants, providing a more complete picture of the functional impact of mutations .

How can researchers address data inconsistencies when comparing in vitro and in vivo studies of Recombinant Barbarea verna Apocytochrome f function?

Addressing inconsistencies between in vitro and in vivo studies of Recombinant Barbarea verna Apocytochrome f requires systematic investigation of experimental factors that differ between these contexts. Researchers should first examine protein modifications, as recombinant systems may produce proteins lacking post-translational modifications present in vivo. Differences in lipid environments should be quantified, as membrane composition dramatically affects protein dynamics and interaction surfaces. For kinetic discrepancies, researchers should investigate how macromolecular crowding and local concentration effects in thylakoid membranes impact reaction rates compared to dilute in vitro systems. Methodological approaches to reconcile these differences include developing more complex reconstitution systems that better mimic the native environment, such as incorporating additional components of the electron transport chain or using thylakoid membrane extracts. Researchers should also consider employing single-molecule techniques that can detect functional heterogeneity masked in bulk measurements. When inconsistencies persist, computational methods such as systems biology modeling can identify additional factors that might explain the discrepancies. Throughout this process, researchers should maintain detailed documentation of all experimental conditions, as seemingly minor differences in buffer components, protein purification methods, or storage conditions can significantly impact functional outcomes. Integration of data from multiple complementary techniques often provides the most comprehensive understanding of how in vitro observations relate to in vivo function .

What emerging technologies show promise for advancing research on Recombinant Barbarea verna Apocytochrome f?

Several cutting-edge technologies are poised to transform research on Recombinant Barbarea verna Apocytochrome f in the coming years. Cryo-electron tomography offers the potential to visualize the protein in its native membrane environment with near-atomic resolution, revealing structural details impossible to capture with traditional techniques. AI-powered protein structure prediction tools like AlphaFold2 can generate highly accurate structural models, particularly valuable for studying mutant variants without the need for crystallization. Single-molecule FRET and force spectroscopy techniques allow researchers to observe dynamic conformational changes during electron transfer events in real-time. Advanced mass spectrometry methods, including native MS and ion mobility MS, enable analysis of intact protein complexes and their dynamics with unprecedented detail. For genetic manipulation, CRISPR-Cas9 genome editing permits precise modification of the petA gene in vivo to study the effects of specific mutations in the context of the whole organism. Microfluidic platforms coupled with high-throughput screening approaches facilitate rapid testing of conditions affecting protein function and stability. Additionally, quantum mechanical/molecular mechanical simulations can model electron transfer processes with increasing accuracy, providing theoretical frameworks to interpret experimental results. Researchers should consider how these emerging technologies can be integrated into comprehensive research programs to address longstanding questions about this crucial photosynthetic component .

What are the potential applications of Recombinant Barbarea verna Apocytochrome f in synthetic biology and biotechnology?

Recombinant Barbarea verna Apocytochrome f holds significant potential in several synthetic biology and biotechnology applications. In bioenergy research, engineered variants with altered redox properties could enhance electron transfer efficiency in artificial photosynthetic systems designed for hydrogen production or other solar fuels. For biosensor development, the protein's electron transfer capabilities can be harnessed to create redox-based detection systems for environmental pollutants or metabolites, utilizing conformational changes upon electron transfer as detection signals. In agricultural biotechnology, engineering apocytochrome f could potentially enhance photosynthetic efficiency in crop plants, particularly under stress conditions where electron transport often becomes a limiting factor. The protein could also serve as a model system for studying membrane protein folding and stability, with broader applications in therapeutic protein development. In bioremediation applications, engineered electron transport proteins could enhance the capabilities of photosynthetic microorganisms to detoxify environmental contaminants through redox transformations. Researchers pursuing these applications should focus on protein engineering approaches that enhance stability outside native environments and optimize expression in relevant host organisms. Potential challenges include maintaining proper folding and heme incorporation in non-native systems, ensuring compatible electron transfer partners are present, and developing strategies to integrate the modified proteins into existing biological or artificial systems .

How might studying Recombinant Barbarea verna Apocytochrome f contribute to understanding evolutionary adaptations in photosynthetic organisms?

Studying Recombinant Barbarea verna Apocytochrome f provides valuable insights into evolutionary adaptations of photosynthetic mechanisms across diverse lineages. Comparative analysis of sequence conservation patterns can identify functionally critical residues maintained throughout evolution versus regions that have diverged to accommodate specific environmental adaptations. Researchers can reconstruct ancestral sequences using phylogenetic methods and express these reconstructed proteins to understand the functional consequences of evolutionary changes. Particular attention should be given to species adapted to extreme environments (high light, temperature extremes, or unusual pH conditions) to identify molecular adaptations that maintain electron transport under stress. Analysis of coevolution between apocytochrome f and its interaction partners (particularly plastocyanin and the Rieske iron-sulfur protein) can reveal how these protein-protein interfaces have been maintained or modified across evolutionary history. Rates of synonymous versus non-synonymous substitutions in the petA gene across plant lineages can identify regions under positive or purifying selection. Through systematic functional characterization of apocytochrome f from species representing key evolutionary transitions, researchers can develop models for how this crucial component of the photosynthetic apparatus has been refined through natural selection to optimize energy capture in diverse photosynthetic organisms. This evolutionary perspective provides context for interpreting functional data and can guide protein engineering efforts aimed at enhancing photosynthetic efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.