Recombinant Barbarea verna ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Barbarea verna ATP synthase subunit a (atpI) is a 249-amino acid protein (UniProt ID: A4QK93) with an N-terminal His tag for purification . It belongs to the F0 sector of ATP synthase, which facilitates proton translocation to drive ATP synthesis . The native atpI subunit is encoded by the chloroplast genome and forms part of a multi-subunit complex essential for photosynthetic energy conversion .

Recombinant Production

The protein is expressed in E. coli systems and purified via affinity chromatography . Key specifications include:

ParameterDetails
Host systemE. coli (BL21 derivatives)
TagN-terminal His tag for immobilized metal affinity chromatography
Purity≥85% (verified by SDS-PAGE)
YieldMilligram quantities achievable

This method enables soluble expression of the hydrophobic atpI subunit, overcoming challenges in eukaryotic membrane protein production .

Functional Role in ATP Synthase

  • Proton translocation: Forms part of the F0 channel, coupling proton movement to rotational catalysis in the F1 sector .

  • Biogenesis: Requires assembly factors like BFA3 for integration into the CF1 subcomplex .

  • Regulation: The αCTD domain interacts with the γ-subunit to block ATP hydrolysis while permitting ATP synthesis .

Research Applications

  • Mechanistic studies: Used to investigate stoichiometric variations in c-subunit rings and proton/ATP coupling ratios .

  • Mutational analysis: Deletions in αCTD (e.g., residues 514–548) reveal its role in latent ATPase activity .

  • Biotechnological tools: Serves as a template for engineering stress-tolerant crops with enhanced photosynthetic efficiency .

Comparative Insights

Recombinant atpI homologs from plants like Spinacia oleracea (spinach) and Hordeum vulgare (barley) share:

  • 85–90% sequence identity with B. verna atpI .

  • Similar purification protocols using E. coli expression .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Barbarea verna (Early yellowrocket) (Erysimum vernum)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVIAI RNPQTIPTDGQNFFEFVLEFIRDVSQTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH
Uniprot No.

Target Background

Function
A key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the atpI gene organized in the chloroplast genome of Barbarea verna?

The atpI gene in Barbarea verna is encoded in the chloroplast genome, which has a typical quadripartite structure consisting of a large single copy (LSC) region, a small single copy (SSC) region, and two inverted repeat regions (IRa and IRb) .

Based on comparative chloroplast genome analyses:

  • The atpI gene is typically located in the LSC region of the chloroplast genome

  • The gene is approximately 750 bp in length, encoding the 249-amino acid protein

  • Like other members of Brassicaceae, the organization of the Barbarea verna chloroplast genome is highly conserved, with a total size of approximately 160 kb

Phylogenomic studies have shown that the chloroplast genome of Barbarea verna is similar to other Brassicaceae species, though the exact gene order and synteny can provide insights into evolutionary relationships within this family .

What expression systems are most effective for producing recombinant Barbarea verna atpI?

For the production of recombinant Barbarea verna atpI, E. coli has been demonstrated as an effective expression system . The research data indicates:

Expression SystemVector TypeTagYieldPurityReference
E. colipET-based vectorN-terminal His tagModerate to high>90%

Key methodological considerations include:

  • Codon optimization: Since plant chloroplast genes can contain codons rarely used in E. coli, codon optimization may improve expression levels.

  • Induction conditions: Expression at lower temperatures (16-20°C) after IPTG induction helps maintain protein solubility.

  • Buffer composition: The use of Tris/PBS-based buffer with 6% trehalose at pH 8.0 enhances stability during purification and storage .

  • Solubility enhancement: Addition of mild detergents such as n-dodecyl-β-D-maltoside (DDM) or CHAPS may improve the solubility of this membrane protein.

Alternative expression systems such as plant-based transient expression or insect cell systems could theoretically provide more native-like post-translational modifications, though these have not been specifically documented for Barbarea verna atpI.

How does Barbarea verna atpI compare with ATP synthase components in other plant species?

Comparative analysis of Barbarea verna atpI with homologs in other plant species reveals both conserved features and unique characteristics:

  • Sequence conservation: The core functional domains show high conservation across Brassicaceae species, particularly in regions involved in proton translocation and interaction with other ATP synthase subunits.

  • Evolutionary divergence: Phylogenetic analyses of chloroplast-encoded proteins including atpI demonstrate that Barbarea verna is closely related to other members of Brassicaceae but shows distinct evolutionary patterns from non-cruciferous plants .

  • Structural comparison:

    • The transmembrane helices that form the proton channel are highly conserved

    • The N-terminal region shows greater variability between species

    • The C-terminal domain contains species-specific features that may reflect adaptation to different environmental conditions

In comparative analyses with model plants like Arabidopsis thaliana, ATP synthase components show patterns of molecular evolution consistent with functional selection, with proteins like rbcL frequently under positive selection . While atpI hasn't been specifically identified under such selection in the available data, its critical role in energy metabolism suggests it may be subject to similar evolutionary pressures.

What methods are recommended for functional characterization of recombinant Barbarea verna atpI?

Functional characterization of recombinant Barbarea verna atpI requires specialized techniques that address its role within the ATP synthase complex:

  • Reconstitution in liposomes:

    • Purified recombinant atpI can be reconstituted into liposomes along with other ATP synthase components

    • Proton translocation can be measured using pH-sensitive fluorescent dyes

    • ATP synthesis activity can be assessed by coupling with luciferase-based ATP detection systems

  • Site-directed mutagenesis approaches:

    • Key residues identified through sequence alignment with well-characterized ATP synthase subunits

    • Mutations of conserved charged residues in transmembrane domains to evaluate their role in proton translocation

    • Creation of chimeric proteins with atpI from other species to identify functionally critical regions

  • Protein-protein interaction studies:

    • Pull-down assays using His-tagged Barbarea verna atpI to identify interaction partners

    • Cross-linking experiments to map the topology of atpI within the ATP synthase complex

    • Surface plasmon resonance (SPR) to quantify binding kinetics with other ATP synthase subunits

  • Complementation studies:

    • Expression of Barbarea verna atpI in ATP synthase-deficient bacterial or yeast strains

    • Assessment of functional complementation through growth phenotypes and ATP synthesis measurements

These approaches provide comprehensive insights into both the structural and functional properties of this important membrane protein component.

How does vernalization affect atpI expression and function in Barbarea verna?

Barbarea verna requires vernalization (extended cold treatment) to induce flowering, and this process has significant effects on energy metabolism and potentially on ATP synthase components :

  • Expression patterns during vernalization:

    • Studies in Barbarea verna show that plants must receive at least 5 weeks of vernalization (at approximately 4°C) to flower effectively

    • During cold exposure, cellular H⁺-ATPases are affected, leading to cytoplasmic acidification

    • Energy metabolism genes, potentially including ATP synthase components, may undergo regulatory changes to adapt to these conditions

  • Metabolic adjustments during vernalization:

    • Vernalization triggers changes in carbohydrate metabolism and amino acid synthesis

    • These changes may indirectly affect ATP synthase activity and regulation

    • Amino acids like GABA and alanine increase during cold treatment, which may buffer cytoplasmic acidosis and regulate pH

  • Post-vernalization recovery:

    • After vernalization, plants enter a reproductive phase with different energy requirements

    • ATP synthase components may be regulated to support the increased energy demands of flowering

While direct evidence linking vernalization specifically to atpI regulation is limited, understanding the broader changes in energy metabolism during this critical developmental transition provides context for future investigations into the role of ATP synthase components in Barbarea verna development.

What approaches are most effective for optimizing the stability of recombinant Barbarea verna atpI?

Membrane proteins like atpI present significant challenges for structural and functional studies due to stability issues. Advanced approaches for optimizing recombinant Barbarea verna atpI stability include:

  • Buffer optimization through thermal shift assays:

    • Systematic screening of buffer conditions using differential scanning fluorimetry

    • The documented storage buffer (Tris/PBS-based with 6% trehalose, pH 8.0) provides a starting point

    • Addition of specific lipids that mimic the chloroplast membrane environment

  • Protein engineering strategies:

    • Introduction of disulfide bonds to stabilize tertiary structure

    • Fusion with stability-enhancing proteins (e.g., T4 lysozyme, BRIL)

    • Truncation of flexible regions while preserving functional domains

  • Nanodiscs and other membrane mimetics:

    • Incorporation into nanodiscs with defined lipid composition

    • Use of amphipols or styrene-maleic acid copolymer lipid particles (SMALPs)

    • Selection of detergents based on systematic solubility screening

  • Co-expression with interacting partners:

    • Co-expression with other ATP synthase subunits to form stabilizing interactions

    • Use of molecular chaperones to assist proper folding

The current recommendation for storage includes aliquoting at -20°C/-80°C to avoid repeated freeze-thaw cycles, and reconstitution to 0.1-1.0 mg/mL in deionized sterile water with 5-50% glycerol for long-term storage .

How can structural studies of Barbarea verna atpI contribute to understanding ATP synthase evolution across plant species?

Structural studies of Barbarea verna atpI can provide significant insights into ATP synthase evolution in plants:

  • Evolutionary adaptation of energy metabolism:

    • Structural comparisons across diverse plant lineages can reveal adaptive changes in ATP synthase

    • Identification of lineage-specific structural features may correlate with ecological adaptations

    • Comparative analyses of ATP synthase components have already revealed significant evolutionary divergence in apicomplexan species, suggesting similar patterns may exist in plants

  • Methodological approaches:

    • Cryo-electron microscopy of purified ATP synthase complexes containing Barbarea verna atpI

    • X-ray crystallography of stabilized atpI constructs

    • Molecular dynamics simulations to predict structural dynamics in different lipid environments

  • Structural basis for functional differences:

    • Comparison with ATP synthase structures from other organisms can highlight plant-specific features

    • Mapping of conserved vs. variable regions onto structural models to identify functionally critical domains

    • Correlation of structural features with environmental adaptations in different Brassicaceae species

  • Chloroplast genome evolution insights:

    • Chloroplast-encoded ATP synthase components reflect evolutionary history

    • Studies of chloroplast genomes in Brassicaceae have already identified patterns of molecular evolution

    • Structural studies can complement sequence-based analyses to provide a more complete evolutionary picture

These approaches can provide valuable insights into how ATP synthase has evolved in different plant lineages and how structural adaptations contribute to functional diversity.

What role does atpI play in abiotic stress responses in Barbarea verna?

Understanding the role of atpI in abiotic stress responses requires integration of multiple research approaches:

  • Transcriptomic and proteomic analyses:

    • Quantitative assessment of atpI expression under different stress conditions

    • Comparison with other ATP synthase components to identify coordinated regulation

    • Integration with metabolomic data to correlate energy metabolism changes with stress responses

  • Functional implications in stress responses:

    • ATP synthesis is critical for stress adaptation, particularly under conditions affecting energy metabolism

    • Barbarea verna shows significant defense metabolite production in response to abiotic stressors, including nasturlexins and other phytoalexins

    • These defense responses require energy, potentially involving ATP synthase regulation

  • Comparative analysis across Brassicaceae:

    • Barbarea verna and B. vulgaris contain unique defense pathways that may be transferable to agriculturally important crops

    • Energy metabolism components like atpI may contribute to the efficiency of these defense responses

    • Comparison with stress-sensitive species can highlight adaptations in ATP synthase components

  • Environmental adaptation mechanisms:

    • Barbarea verna requires specific vernalization conditions for flowering , suggesting adaptation to seasonal temperature fluctuations

    • ATP synthase function may be modulated during temperature stress to maintain energy homeostasis

    • Conservation of the psbA gene in B. sacra has been linked to drought tolerance , suggesting similar adaptation mechanisms may exist for ATP synthase components

These integrated approaches can illuminate how atpI contributes to Barbarea verna's adaptation to environmental stressors.

How can protein interaction networks involving Barbarea verna atpI be characterized for understanding chloroplast function?

Characterizing the protein interaction network of Barbarea verna atpI requires sophisticated approaches to capture both stable and transient interactions within the chloroplast:

These approaches provide a comprehensive framework for understanding how atpI functions within the broader context of chloroplast energy metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.