Recombinant Barbarea verna Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Introduction

Chloroplasts, essential organelles in plant cells, are demarcated by a double-membrane envelope critical for their function and interaction with the rest of the cell . The envelope membranes, composed of an outer and inner membrane, facilitate various transport activities necessary for chloroplast metabolism . Within this complex system lies the Chloroplast Envelope Membrane protein CemA. CemA proteins are located in the inner envelope membrane of chloroplasts, but not in the thylakoid membrane . Though studied in various organisms, information specific to recombinant Barbarea verna CemA is limited. This review consolidates available information regarding CemA proteins, their function, and their significance within the chloroplast.

General Characteristics of CemA Proteins

CemA proteins are probable integral membrane proteins . They are found in the inner envelope membrane of chloroplasts, playing a crucial role in the transport of molecules across this membrane .

Key characteristics of CemA proteins:

  • Integral membrane proteins

  • Located in the inner envelope membrane of chloroplasts

  • Involved in transport activities across the chloroplast envelope

Function and Role

  • Proton Extrusion: A cyanobacterial member of the CemA family, proton extrusion protein PcxA, facilitates light-induced Na+^+-dependent proton extrusion .

  • Inorganic Carbon Uptake: CemA indirectly promotes efficient inorganic carbon uptake into chloroplasts .

  • CO2 Transport: PcxA has been implicated in CO2 transport, though it is likely not a CO2 transporter itself .

Identification and Proteomic Studies

Proteomic studies have been instrumental in identifying and characterizing envelope proteins, including CemA. These studies often involve:

  1. Membrane Fractionation: Highly purified and characterized membrane fractions are used .

  2. Hydrophobic Protein Extraction: Organic solvents extract hydrophobic proteins .

  3. SDS/PAGE Separation: Proteins are separated using SDS/PAGE .

  4. Mass Spectrometry Analysis: Tandem mass spectrometry is performed .

  5. Data Analysis: Blast-based programs search protein, expressed sequence tag, and genomic plant databases .

Overexpression Studies

Overexpression of envelope membrane proteins can induce membrane proliferation, leading to structural changes in the chloroplast envelope . This phenomenon can be utilized to determine the localization of unknown proteins within the inner or outer envelope membrane .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Barbarea verna (Early yellowrocket) (Erysimum vernum)
Target Names
cemA
Target Protein Sequence
MAKKKAFIPFFYFTSIVFLPWLISLCCNKSLKTWITTWWNTRQCETFLNDIQEKSVLEKF IQLEDLFQLDEMIKEYPETDLQQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFWGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRISPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the CemA protein and what is its significance in plant biology?

CemA (Chloroplast envelope membrane protein A) is a chloroplast-encoded protein that localizes to the inner envelope membrane of chloroplasts . It is notable for being one of the few plastid-encoded proteins that target the inner envelope rather than the thylakoid membrane . The protein consists of 229 amino acids in Barbarea verna and contains multiple predicted transmembrane segments . CemA's function, while not fully characterized, appears to be related to chloroplast envelope metabolism and potentially CO₂ uptake systems. Understanding CemA is significant for comprehending chloroplast biogenesis, envelope membrane organization, and potentially for engineering improved photosynthetic efficiency in crops.

What expression systems are used for producing recombinant CemA protein?

The most common expression system for producing recombinant Barbarea verna CemA protein is E. coli . The protein is typically expressed with an N-terminal His-tag for purification purposes. The recombinant protein is often provided as a lyophilized powder and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with recommended addition of 5-50% glycerol for long-term storage at -20°C/-80°C . Alternative expression systems, including plant-based systems for chloroplast protein expression, can also be employed but require specific targeting strategies to direct the protein to the correct membrane .

What methods can be used to verify the localization of recombinant CemA to the chloroplast inner envelope membrane?

Multiple complementary approaches should be used to verify CemA localization:

  • Chloroplast fractionation: Isolate chloroplasts and fractionate into stroma, envelope, and thylakoid membranes. Analyze each fraction by SDS-PAGE and immunoblotting using antibodies against the recombinant protein and marker proteins for each compartment .

  • Protease protection assays: Treat intact chloroplasts with trypsin, which permeates the outer envelope membrane but not the inner envelope membrane. Inner envelope membrane proteins oriented toward the intermembrane space are protected from digestion .

  • Membrane integration tests:

    • Alkaline extraction (0.2 M Na₂CO₃, pH 12.0): Integral membrane proteins resist extraction

    • Detergent solubilization (1% Triton X-100): Membrane proteins become soluble

    • Compare results with known integral membrane proteins

  • Microscopy techniques: Use fluorescent protein fusions or immunogold labeling with electron microscopy to visualize protein localization .

  • Enrichment factor calculation: For proteomics approaches, calculate an enrichment factor by comparing the abundance of the protein in purified envelope fractions versus total chloroplast or crude cell extracts .

How can experimental designs distinguish between contamination and true localization in envelope membrane preparations?

Distinguishing true envelope localization from contamination requires rigorous controls:

  • Marker protein analysis: Include marker proteins for different compartments in all analyses (e.g., LSU for stroma, Tic110 for envelope, LHCP for thylakoid) .

  • Multiple purification techniques: Apply different purification approaches and compare results.

  • Statistical validation: For proteomics studies, use multivariable logistic regression to model the probabilities for classification of envelope localization .

  • Cross-comparison methods: Use spatial proteomics comparing protein distribution across multiple subcellular fractions .

  • Validation with independent techniques: Confirm localization using microscopy or in vitro import assays.

How does the targeting mechanism of CemA to the chloroplast inner envelope membrane differ from thylakoid membrane targeting?

The targeting mechanism of CemA to the inner envelope membrane involves distinct features:

  • Unique ribosome behavior: Despite containing transmembrane segments (TMSs), ribosomes translating cemA behave differently from those synthesizing thylakoid proteins. CemA ribosome footprints are recovered predominantly in the soluble fraction, suggesting a post-translational targeting mechanism .

  • N-terminal signal features: CemA contains a distinctive N-terminus that resembles a bacterial signal sequence - a lysine-rich segment followed by a predicted TMS (MKKKKALPSFLYLVFIVLLPWGVSFSF…) .

  • Hypothesis for sorting mechanism: The lysine-rich stretch at the CemA N-terminus may either interfere with the engagement of thylakoid translocons or be quickly bound by a protein that masks the TMS from thylakoid targeting machineries .

This differs significantly from thylakoid protein targeting, which typically occurs cotranslationally for proteins with transmembrane segments.

What approaches can be used to express functional recombinant cyanobacterial bicarbonate transporters in the chloroplast inner envelope membrane?

Engineering functional cyanobacterial bicarbonate transporters (like BicA and SbtA) in the chloroplast inner envelope membrane involves several strategic approaches:

  • Nuclear transformation: Transform the chimeric genes into the nuclear genome rather than the plastid genome. Nuclear transformation can be performed in numerous plant species and allows for the targeting of the expressed protein to specific locations .

  • Verification of membrane integration: Confirm that the bicarbonate transporter portion is properly integrated into the membrane using approaches like protease cleavage sites between the targeting signal and the transporter .

  • Optimization of transporter activity: The addition of targeting signals may inhibit transporter activity. If necessary, design systems to remove the targeting signal after membrane integration (e.g., using TEV protease cleavage sites) .

  • Functional assays: Develop assays to measure bicarbonate transport activity of the recombinant protein in the chloroplast envelope .

This approach differs from expressing transporters from the plastid genome, which has been shown to result in thylakoid membrane targeting rather than envelope membrane targeting .

How can differential proteomics approaches identify envelope proteins critical for specific physiological processes?

Differential proteomics can identify envelope proteins involved in specific physiological processes:

  • Enrichment factor profiling: Calculate enrichment factors for each protein across conditions to identify those with significant changes .

  • Multivariable statistical modeling: Use logistic regression to model probabilities for classification of proteins with altered abundance .

  • Integration with transcriptomics: Combine proteome data with transcriptome data to identify coordinated responses.

This approach can reveal novel proteins involved in stress responses, developmental transitions, or other physiological processes.

What are the main challenges in producing high-purity recombinant CemA protein and how can they be addressed?

Production of high-purity recombinant CemA presents several challenges:

  • Membrane protein solubility: As an integral membrane protein, CemA has hydrophobic regions that can cause aggregation during expression and purification.

    • Solution: Use specialized detergents or lipid nanodiscs to maintain solubility . Optimize buffer conditions with appropriate detergents for solubilization.

  • Proper folding: Ensuring correct folding of transmembrane segments.

    • Solution: Express at lower temperatures (16-20°C) to slow folding, or use specialized E. coli strains designed for membrane protein expression.

  • Purification challenges: Maintaining protein stability during purification steps.

    • Solution: Use rapid purification protocols and keep the protein in suitable detergent solutions throughout purification .

  • Protein degradation: Preventing proteolytic degradation.

  • Protein yield: Typically low yields for membrane proteins.

    • Solution: Optimize codon usage for the expression system and use high cell-density fermentation techniques.

  • Functional verification: Confirming that the recombinant protein is functionally active.

    • Solution: Develop functional assays specific to the predicted activity of CemA, possibly related to CO₂ uptake or envelope membrane organization.

How can researchers overcome issues with cross-contamination between chloroplast compartments during fractionation studies?

Cross-contamination between chloroplast compartments can be minimized through several strategies:

  • Multiple purification steps: Implement sequential purification steps to reduce contamination .

  • Complementary approaches: Use independent methods (microscopy, in vitro import) to validate localization results .

  • Quantitative proteomics: Use stable isotope labeling or label-free quantification to accurately measure protein distribution across fractions .

What experimental design approaches help distinguish genuine envelope localization from artifacts in proteomics studies?

To distinguish genuine envelope proteins from artifacts in proteomics studies:

  • Statistical filtering: Apply statistical cutoffs based on enrichment factors and abundance measurements .

  • Experimental replication: Perform multiple biological replicates to increase statistical power.

  • Control for technical artifacts: Include negative controls and analyze preparation-specific contaminants.

  • Comparative analysis across species: Compare envelope proteomes from different plant species to identify conserved envelope proteins.

How might understanding CemA structure and function contribute to improving photosynthetic efficiency in crops?

Understanding CemA could contribute to crop improvement through several avenues:

  • Envelope membrane organization: CemA may influence the organization of the chloroplast envelope, which is critical for metabolite exchange between the chloroplast and cytosol .

  • Stress response mechanisms: Understanding how CemA functions during environmental stresses could lead to more resilient crops .

  • Envelope biogenesis: Insights into how chloroplast-encoded proteins like CemA are targeted to the envelope could reveal new approaches for engineering this membrane .

  • Synthetic biology applications: CemA targeting mechanisms could be exploited for installing novel functionalities in the chloroplast envelope .

What are the methodological considerations for studying protein-protein interactions involving CemA in the chloroplast envelope?

Studying protein-protein interactions of CemA requires specialized approaches:

  • Co-immunoprecipitation with mild detergents: Use gentle detergents to solubilize membrane proteins while maintaining interactions.

  • Chemical cross-linking coupled with mass spectrometry: This approach can capture transient interactions in their native membrane environment.

  • Blue native PAGE: Allows separation of protein complexes in their native state.

  • Bimolecular fluorescence complementation (BiFC): Can visualize protein interactions in vivo when used with appropriate targeting signals.

  • Proximity-based labeling: Techniques like BioID or APEX can identify proteins in the vicinity of CemA in vivo.

  • Liposome reconstitution: Reconstituting purified proteins in liposomes can allow functional studies of interactions.

  • Structural biology approaches: Techniques like cryo-EM may reveal interaction interfaces when applied to purified complexes.

When designing these studies, researchers must consider:

  • The hydrophobic nature of CemA and potential interaction partners

  • The need to maintain the lipid environment for proper protein conformation

  • The potential for artifacts due to overexpression or tagging

  • The cellular context of the chloroplast envelope

What emerging technologies might advance our understanding of chloroplast envelope membrane proteins like CemA?

Several emerging technologies hold promise for advancing chloroplast envelope membrane protein research:

  • Cryo-electron tomography: Could reveal the native organization of CemA and other proteins within the chloroplast envelope at near-atomic resolution.

  • In situ structural biology: Techniques like cellular cryo-electron tomography combined with subtomogram averaging could visualize membrane protein complexes in their native context.

  • Single-molecule tracking: Could reveal the dynamics of CemA within the membrane.

  • Genome editing with CRISPR/Cas9: Precise modification of the cemA gene in the chloroplast genome could help elucidate structure-function relationships.

  • Single-organelle proteomics: Analyzing the proteome of individual chloroplasts could reveal heterogeneity in CemA expression or localization.

  • Computational prediction tools: Improved algorithms for predicting membrane protein structure, dynamics, and interactions could guide experimental approaches.

  • Microfluidics and organ-on-chip approaches: Could allow manipulation and analysis of chloroplasts under controlled conditions.

  • Multi-omics integration: Combining proteomics, lipidomics, and metabolomics could provide a comprehensive view of CemA's role in chloroplast envelope function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.