Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a protein component involved in the NAD(P)H dehydrogenase (NDH) complex found in the chloroplasts of Barbarea verna, also known as land cress or early yellowrocket . The NDH complex is crucial for various electron transport processes within the chloroplast, particularly those related to photosynthesis and stress response .

Function and Role

The NAD(P)H-quinone oxidoreductases (NDH-2) catalyze the transfer of electrons from NAD(P)H to quinones without directly transducing energy . Specifically, the NDH complex, which includes the Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is involved in:

Expression and Localization

The protein is expressed in the chloroplasts of Barbarea verna . The expression region for this subunit is typically from amino acids 1-120, indicating the functional domain resides within this region .

Quinone Oxidoreductases and their role

Quinone oxidoreductases, including Recombinant Human Quinone oxidoreductase protein, catalyze the reduction of quinones to hydroquinones, using NAD(P)H as an electron donor . This enzymatic activity is crucial for cellular detoxification and maintaining redox balance .

Research and Applications

Studying Barbarea verna NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, and related enzymes, can provide insights into plant stress responses, photosynthesis regulation, and potential biotechnological applications .

Related Research

Other research concerning quinone oxidoreductases includes:

  • The synthesis and evaluation of naphthoquinone analogs as proteasome inhibitors, highlighting their potential in cancer therapy .

  • Investigation into the roles of chloroplast lipid droplets and associated quinone oxidoreductases in energy and prenylquinone metabolism .

  • Studies on marine naphthoquinone-naphthol derivatives as anticancer agents .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Barbarea verna (Early yellowrocket) (Erysimum vernum)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDIFWAFLIISSAIPVLAFFISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially a chloroplast respiratory chain. In this species, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the catalytic mechanism of plant NAD(P)H-quinone oxidoreductases differ from mammalian NQO1?

While both plant chloroplastic NAD(P)H-quinone oxidoreductases and mammalian NQO1 catalyze similar redox reactions, their mechanisms and structural organizations differ significantly:

FeaturePlant chloroplastic NAD(P)H-quinone oxidoreductaseMammalian NQO1
Cellular locationChloroplastCytosol
Subunit compositionMulti-subunit complexHomodimer
Cofactor bindingContains iron-sulfur centersFAD-dependent
Reaction specificityPrimarily involved in photosynthetic electron transportBroad substrate specificity for quinones and xenobiotics
Evolutionary originCyanobacterial ancestryEukaryotic development

The plant enzyme functions as part of a larger complex involved in photosynthetic metabolism, while mammalian NQO1 operates via a substituted enzyme mechanism involving a tightly bound FAD cofactor and functions in detoxification and redox homeostasis . The plant enzyme's structure reflects its specialized role in photosynthetic organisms, whereas NQO1 has evolved for detoxification in aerobic, non-photosynthetic organisms.

What are the optimal conditions for expressing and purifying recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 3?

The optimal expression and purification conditions for this recombinant protein require careful consideration of several factors:

Expression System Selection:
Based on the literature and commercial production information, bacterial expression systems (particularly E. coli) are commonly used for chloroplastic proteins . For this specific protein, the following parameters have been established:

Purification Protocol:

  • Expression in a suitable host system (typically E. coli)

  • Cell lysis in Tris-based buffer

  • Affinity chromatography using an appropriate tag (tag type is determined during the production process)

  • Buffer exchange to a stabilizing Tris-based buffer containing 50% glycerol

  • Quality control testing including SDS-PAGE and activity assays

Storage Conditions:
The purified protein should be stored at -20°C for short-term use or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise the protein's integrity and activity .

How can researchers accurately measure the enzymatic activity of recombinant NAD(P)H-quinone oxidoreductase in experimental settings?

Accurate measurement of NAD(P)H-quinone oxidoreductase activity requires specialized assays that account for the protein's electron transfer capabilities:

Spectrophotometric Assays:
The most common approach involves monitoring the oxidation of NAD(P)H spectrophotometrically at 340 nm while using various electron acceptors. For chloroplastic NAD(P)H-quinone oxidoreductase, the following methodology is recommended:

  • Prepare reaction buffer containing 50 mM Tris-HCl (pH 7.5), 0.1% BSA, and appropriate cofactors

  • Add purified enzyme (typically 0.5-5 μg)

  • Initiate reaction by adding NAD(P)H (final concentration 100-200 μM)

  • Monitor decrease in absorbance at 340 nm

  • Calculate activity using the extinction coefficient of NAD(P)H (ε = 6,220 M⁻¹ cm⁻¹)

Alternative Substrates:
Based on studies of similar enzymes, researchers can use various substrates to assess activity:

  • Natural quinones (plastoquinone, ubiquinone)

  • Artificial electron acceptors (dichlorophenolindophenol, menadione)

  • Ferricyanide for measuring general electron transfer capability

For specialized applications, high-performance liquid chromatography (HPLC) or mass spectrometry may be employed to detect specific reaction products with greater sensitivity .

How can protein mobility studies help understand the function and regulation of NAD(P)H-quinone oxidoreductase complexes?

Protein mobility studies provide crucial insights into the structure-function relationships of NAD(P)H-quinone oxidoreductases. Research on related enzymes has demonstrated that protein dynamics play essential roles in enzyme function:

Key Findings from Mobility Studies:
Research on the human NQO1 has shown that appropriate protein mobility is crucial for normal function, while inappropriate mobility can lead to dysfunction . This principle likely extends to plant NAD(P)H-quinone oxidoreductases as well.

Methodological Approaches:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify regions of conformational flexibility by measuring the rate of hydrogen-deuterium exchange in different parts of the protein.

  • Molecular dynamics simulations: Computational approaches can model the dynamic behavior of the protein under various conditions.

  • NMR spectroscopy: Solution NMR can provide atomic-level information about protein dynamics in solution.

  • Single-molecule FRET: This approach can detect conformational changes in real-time.

The application of these techniques to NAD(P)H-quinone oxidoreductase subunit 3 could reveal how structural dynamics contribute to:

  • Substrate binding and recognition

  • Inter-subunit communication within the complex

  • Regulation of electron transfer efficiency

  • Adaptation to changing environmental conditions

Studies suggest that negative cooperativity, observed in related enzymes like human NQO1, may be mediated by alterations in protein mobility. This cooperativity could function to "dampen" the response to changes in substrate or cofactor concentration, providing a fine-tuning mechanism for enzyme activity .

What are the challenges in studying the interaction of chloroplastic NAD(P)H-quinone oxidoreductase with other components of the photosynthetic electron transport chain?

Studying interactions between chloroplastic NAD(P)H-quinone oxidoreductase and other photosynthetic components presents several methodological challenges that researchers must address:

Major Challenges:

  • Membrane protein complexes: The chloroplastic NAD(P)H-quinone oxidoreductase is part of a membrane-associated complex, making it difficult to isolate while maintaining native interactions.

  • Transient interactions: Many interactions in the electron transport chain are transient and dependent on the energetic state of the chloroplast.

  • Complex reconstruction: Reconstituting the full complex in vitro is technically demanding due to multiple protein components and cofactors.

Methodological Solutions:

  • Crosslinking approaches: Chemical crosslinking followed by mass spectrometry can capture transient interactions.

  • Co-immunoprecipitation with specialized detergents: Using mild detergents that preserve protein-protein interactions during isolation.

  • Cryo-electron microscopy: This technique can visualize large membrane protein complexes in near-native states.

  • Functional complementation studies: Testing the ability of modified NAD(P)H-quinone oxidoreductase to restore function in mutant plants lacking specific components.

  • Blue native PAGE: This technique separates intact protein complexes and can identify subcomplexes and assembly intermediates.

Recent studies of chloroplastic NAD(P)H dehydrogenase complexes have begun to elucidate the complex interactions between different subunits and their roles in cyclic electron flow around photosystem I. Understanding these interactions is crucial for comprehending the protein's role in plant adaptation to different environmental conditions and stress responses .

How does the structure and function of NAD(P)H-quinone oxidoreductase subunit 3 vary across different plant species, and what are the implications for research?

Comparative analysis of NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) across plant species reveals important evolutionary patterns and functional implications:

A sample of predicted reactivity includes:

  • Arabidopsis thaliana (confirmed)

  • Barbarea verna (confirmed)

  • Capsella bursa-pastoris (predicted)

  • Oryza sativa (predicted)

  • Phaseolus vulgaris (predicted)

Functional Implications:
The variability in ndhC structure across species suggests adaptation to different photosynthetic requirements and environmental conditions. Studies in Brassicaceae species such as Barbarea vulgaris have shown how chloroplastic proteins contribute to adaptation to different environments .

Research Considerations:
When designing experiments using recombinant proteins from specific species:

  • Consider the evolutionary context of your model organism

  • Validate antibody cross-reactivity before conducting immunological studies

  • Be aware that functional differences may exist despite sequence similarities

  • Use appropriate reference species when making comparative claims

Understanding these cross-species variations is particularly important when studying plant responses to environmental stresses, as the NAD(P)H dehydrogenase complex plays crucial roles in adaptive photosynthetic regulation .

What insights can be gained from studying NAD(P)H-quinone oxidoreductase in Barbarea verna compared to other Brassicaceae species?

Studying NAD(P)H-quinone oxidoreductase in Barbarea verna offers unique comparative insights within the Brassicaceae family:

Brassicaceae as a Model Family:
The Brassicaceae family includes important model organisms (Arabidopsis thaliana) and crop plants (various Brassica species), making it valuable for comparative studies . Barbarea verna (land cress) represents an interesting species within this family, with distinct ecological adaptations.

Key Comparative Findings:

  • Glucosinolate profiles: Barbarea species have unique glucosinolate profiles that differ from other Brassicaceae, which may relate to redox metabolism involving NAD(P)H-quinone oxidoreductases .

  • Resistance mechanisms: Barbarea vulgaris (a close relative of B. verna) shows resistance to diamondback moth through specialized metabolites, which may involve chloroplastic redox processes .

  • Adaptation to different environments: Studies of Myzus cerasi aphids on B. verna revealed extensive transcriptional changes in genes related to oxidoreductase activity when adapting to this host plant, suggesting unique biochemical interactions .

Research Applications:
Comparative studies of chloroplastic NAD(P)H-quinone oxidoreductase across Brassicaceae can:

  • Illuminate the evolution of photosynthetic regulation mechanisms

  • Provide insights into plant-insect interactions and defense responses

  • Identify potential genetic resources for crop improvement

  • Enhance understanding of plant adaptation to environmental stresses

The recently sequenced genome of Barbarea vulgaris provides a valuable reference for studies of closely related species like B. verna, enabling more detailed molecular investigations of chloroplastic proteins and their functions.

What are the most effective applications of antibodies against recombinant Barbarea verna NAD(P)H-quinone oxidoreductase in plant science research?

Antibodies against recombinant Barbarea verna NAD(P)H-quinone oxidoreductase offer versatile tools for plant science research:

Validated Applications:
Based on similar antibodies against chloroplastic NAD(P)H-quinone oxidoreductase components like NdhB, the following applications have proven effective :

  • Western blotting (WB): For detecting and quantifying the protein in plant extracts (recommended dilution 1:1000).

  • Immunolocalization: For visualizing the spatial distribution of the protein within chloroplasts and plant tissues.

  • Co-immunoprecipitation: For identifying protein-protein interactions within the NAD(P)H dehydrogenase complex.

Experimental Considerations:
When designing experiments with these antibodies, researchers should consider:

  • Cross-reactivity: Antibodies may recognize homologous proteins in related species. The NdhB antibody, for example, shows confirmed reactivity with Arabidopsis thaliana, Hordeum vulgare, and Zea mays, and predicted reactivity with numerous other species including Barbarea verna .

  • Sample preparation: For chloroplastic proteins, proper isolation of intact chloroplasts or thylakoid membranes is crucial for accurate results.

  • Controls: Include positive controls (recombinant protein) and negative controls (samples from knockout plants or unrelated species) to validate antibody specificity.

  • Signal optimization: Chloroplastic proteins may require specialized extraction buffers to maximize signal strength and minimize background.

By utilizing these antibodies in combination with molecular and biochemical techniques, researchers can investigate the assembly, regulation, and function of the NAD(P)H dehydrogenase complex in response to various environmental conditions and developmental stages.

How can researchers effectively design experiments to study the role of NAD(P)H-quinone oxidoreductase in plant stress responses?

Designing robust experiments to investigate NAD(P)H-quinone oxidoreductase's role in plant stress responses requires careful consideration of multiple factors:

Experimental Design Framework:

  • Selection of appropriate stress conditions:

    • Abiotic stresses: drought, high light, temperature extremes, nutrient deficiency

    • Biotic stresses: pathogens, herbivory (particularly relevant given Barbarea species' resistance to certain insects )

    • Combined stresses: to mimic natural conditions

  • Time-course analysis:

    • Short-term responses (minutes to hours): capture immediate changes in enzyme activity and redox status

    • Medium-term responses (hours to days): examine transcriptional and translational changes

    • Long-term responses (days to weeks): assess adaptive changes and acclimation

  • Multi-level analytical approach:

    • Molecular level: gene expression analysis (qRT-PCR, RNA-seq)

    • Protein level: enzyme activity assays, western blotting, proteomics

    • Physiological level: photosynthetic parameters, ROS levels, growth metrics

    • Whole-plant responses: survival rates, biomass accumulation

Methodological Recommendations:

  • For gene expression studies:

    • Design primers specific to Barbarea verna NAD(P)H-quinone oxidoreductase subunit 3

    • Include reference genes validated for stability under the specific stress conditions

    • Consider using digital droplet PCR for absolute quantification

  • For protein function analysis:

    • Compare enzyme activity before, during, and after stress application

    • Assess post-translational modifications using mass spectrometry

    • Examine protein turnover rates using pulse-chase experiments

  • For in vivo functional assessment:

    • Employ chlorophyll fluorescence imaging to monitor photosynthetic efficiency

    • Use specific inhibitors of NAD(P)H dehydrogenase to assess its contribution

    • Consider transgenic approaches (virus-induced gene silencing or CRISPR/Cas9) to modulate gene expression

When interpreting results, researchers should consider the complex integration of NAD(P)H-quinone oxidoreductase within the broader photosynthetic electron transport system and cellular redox network, which may involve compensation by alternative pathways when this enzyme's function is altered.

What strategies can researchers use to resolve contradictory data regarding NAD(P)H-quinone oxidoreductase function across different experimental conditions?

Contradictory data regarding NAD(P)H-quinone oxidoreductase function can arise from various sources. Researchers can employ the following strategies to resolve such discrepancies:

Sources of Contradictory Data:

  • Different experimental conditions (temperature, light, pH)

  • Varying sample preparation methods

  • Species-specific or tissue-specific differences

  • Technical variability in assay methods

  • Differential post-translational modifications

Resolution Strategies:

  • Standardized experimental protocols:

    • Implement consistent buffer compositions, temperatures, and reaction kinetics

    • Document detailed methodologies to enable accurate replication

    • Validate enzyme activity assays with known standards

  • Comprehensive condition testing:

    • Systematically test enzyme function across a range of pH values, temperatures, and ionic strengths

    • Create response surface models to identify optimal conditions and interaction effects

    • Compare activity patterns in different developmental stages and tissues

  • Multiple methodological approaches:

    • Use complementary techniques to measure enzyme activity (spectrophotometric, polarographic, fluorometric)

    • Employ both in vitro reconstitution and in vivo assessment approaches

    • Validate findings with both biochemical and genetic methods

  • Meta-analysis approach:

    • Compile data from multiple studies and identify patterns in contradictions

    • Apply statistical methods to evaluate the significance of contradictory findings

    • Identify variables that consistently affect results across studies

Consider the example of human NQO1, where contradictory data regarding cooperativity was ultimately resolved by recognizing the importance of protein dynamics and conformational changes . Similar principles may apply to plant NAD(P)H-quinone oxidoreductases, where protein mobility and inter-subunit communication could explain apparently contradictory functional observations.

How should researchers interpret changes in NAD(P)H-quinone oxidoreductase expression in relation to broader plant metabolic networks?

Interpreting changes in NAD(P)H-quinone oxidoreductase expression requires consideration of its position within complex plant metabolic networks:

Contextual Framework for Interpretation:

  • Integration with photosynthetic electron transport:

    • Changes in NAD(P)H-quinone oxidoreductase expression may reflect adjustments in cyclic electron flow around photosystem I

    • Interpret data in relation to concurrent changes in other photosynthetic components

    • Consider the energetic balance between linear and cyclic electron transport

  • Redox homeostasis network:

    • NAD(P)H-quinone oxidoreductases influence cellular redox status

    • Changes in expression may be compensatory responses to oxidative stress

    • Evaluate in context with other redox-related enzymes (e.g., peroxidases, superoxide dismutases)

  • Metabolic signaling pathways:

    • Expression changes may reflect retrograde signaling from chloroplast to nucleus

    • Consider potential crosstalk with hormonal signaling networks

    • Examine coordination with stress-responsive transcription factors

Analytical Approaches:

  • Network analysis:

    • Apply pathway enrichment analysis to transcriptomic or proteomic datasets

    • Use co-expression networks to identify functionally related genes

    • Implement hierarchical clustering to identify coordinated response patterns

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data for comprehensive interpretation

    • Use statistical approaches like partial least squares regression to identify relationships

    • Develop predictive models of metabolic responses based on enzyme expression changes

  • Comparative physiology:

    • Relate expression changes to physiological parameters (photosynthetic rate, growth, stress tolerance)

    • Compare wild-type and mutant responses to understand functional significance

    • Examine natural variation across ecotypes to identify adaptive patterns

Research on aphid responses to Barbarea verna has demonstrated how oxidoreductase activities can be central to adaptation to different plant hosts and environments , illustrating the importance of considering NAD(P)H-quinone oxidoreductase within broader metabolic networks and ecological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.