Recombinant Barbarea verna NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

What is Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L, and what are its key structural features?

Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L is a chloroplastic protein encoded by the ndhE gene. The full amino acid sequence is MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGNIFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK, representing the complete 101 amino acid sequence with an expression region of 1-101 . The protein has several alternative names including NAD(P)H dehydrogenase subunit 4L and NADH-plastoquinone oxidoreductase subunit 4L . This protein is classified as EC=1.6.5.- and has been assigned the UniProt identifier A4QKF9 . The recombinant form is produced with a tag type determined during the production process, though specific tag information varies by manufacturer.

How does Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L function in chloroplasts?

Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L functions as a component of the chloroplastic electron transport chain, participating in redox reactions involving NAD(P)H as an electron donor and quinones as electron acceptors. By analogy with human NAD(P)H:quinone oxidoreductase 1 (NQO1), it likely catalyzes a 1:1 stoichiometry of oxygen consumption to NADH oxidation with hydrogen peroxide production during auto-oxidation . The protein plays critical roles in energy metabolism within chloroplasts, contributing to the plant's ability to adapt to varying environmental conditions through modulation of electron flow. Research suggests that like its human counterpart, this enzyme may also possess superoxide scavenging activity, thereby contributing to reactive oxygen species (ROS) management within plant cells.

What are the optimal storage and handling conditions for Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L?

For optimal preservation of enzymatic activity, Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L should be stored at -20°C, and for extended storage periods, it is recommended to conserve the protein at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, which has been optimized for protein stability . To maintain integrity, repeated freeze-thaw cycles should be strictly avoided. For ongoing experiments, working aliquots can be stored at 4°C for up to one week without significant loss of activity . When planning experimental timelines, researchers should account for these storage limitations and prepare fresh aliquots as needed to ensure consistent enzymatic performance across experiments.

What are the recommended protocols for studying the superoxide scavenging activity of Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L?

Based on established protocols for human NQO1, researchers can adapt several methodologies to investigate the superoxide scavenging activity of Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L. A comprehensive approach would include:

• Dihydroethidium oxidation assay: Combine the enzyme with NAD(P)H and measure inhibition of dihydroethidium oxidation using fluorescence spectroscopy .

• Pyrogallol auto-oxidation inhibition: Assess the enzyme's ability to inhibit pyrogallol auto-oxidation by monitoring absorbance changes at 420 nm in the presence of various concentrations of the enzyme and NAD(P)H .

• Electron spin resonance (ESR) spectroscopy: Use potassium superoxide-generated ethoxycarbonyl-2-methyl-3,4-dihydro-2H-pyrrole-1-oxide:O2- - adduct signals to determine superoxide scavenging capacity .

• NADH oxidation kinetics: Use xanthine/xanthine oxidase as a source of superoxide and monitor enzyme-dependent NADH oxidation at 340 nm to estimate kinetic parameters for superoxide reduction .

These methods should be calibrated using appropriate controls such as superoxide dismutase to confirm specificity of the observed effects to superoxide scavenging rather than other antioxidant mechanisms.

How can researchers differentiate between the NAD(P)H dehydrogenase and superoxide scavenging activities of the chloroplastic protein?

To distinguish between the primary NAD(P)H dehydrogenase function and the superoxide scavenging activity of Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L, researchers should employ a multi-faceted experimental approach:

How can Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L be utilized in comparative studies with human NAD(P)H:quinone oxidoreductase 1?

Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L presents valuable opportunities for evolutionary and functional comparative studies with human NAD(P)H:quinone oxidoreductase 1 (NQO1). Researchers can design experiments that:

• Compare structural homologies: Perform detailed sequence alignments and structural modeling to identify conserved domains and how structural differences relate to functional adaptations across species.

• Analyze catalytic mechanisms: Examine reaction kinetics, substrate preferences, and cofactor requirements under identical experimental conditions to identify conserved and divergent aspects of enzyme function.

• Investigate redox sensing capabilities: Compare how each enzyme responds to changes in cellular redox state and their respective contributions to redox homeostasis in plant chloroplasts versus human cells.

• Study evolutionary conservation of superoxide scavenging: Determine if the superoxide scavenging capacity observed in human NQO1 is conserved in the plant enzyme, potentially representing an ancient and fundamental property of this enzyme family .

• Assess enzyme-substrate interactions: Use recombinant proteins from both species with various quinone substrates to establish substrate specificity profiles and structure-activity relationships.

These comparative approaches can provide insights into the evolutionary conservation of redox enzymes across kingdoms and identify potentially novel applications based on shared mechanisms.

What are the implications of NAD(P)H:quinone oxidoreductase polymorphisms in disease states and how might plant models contribute to this research?

Research on human NAD(P)H:quinone oxidoreductase 1 (NQO1) gene polymorphisms, particularly rs1800566, has revealed contradictory associations with cancer risk across different populations . Plant models using Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase can contribute to this field in several ways:

• Structural impact analysis: By creating equivalent mutations in the plant enzyme that mimic human polymorphisms, researchers can study effects on protein stability, enzyme kinetics, and substrate binding without the confounding variables present in human studies.

• Oxidative stress response: Investigate how polymorphic variants affect cellular responses to oxidative stress in both plant and animal cells, potentially identifying conserved mechanisms of protection against reactive oxygen species.

• Substrate specificity alterations: Compare how polymorphisms alter the range of substrates metabolized by both human and plant enzymes, which could explain differential disease associations observed in population studies .

• Development of screening methodologies: Establish high-throughput assays using the plant enzyme as a model system for screening compounds that might modify the function of polymorphic variants associated with disease risk.

• Cross-species validation: Use findings from the plant model to validate hypotheses generated from human epidemiological studies that show contradictory results, such as those observed between Thai and American populations regarding cervical cancer risk .

This translational approach leverages the experimental advantages of plant systems to inform our understanding of NAD(P)H:quinone oxidoreductase polymorphisms in human disease.

What are common challenges in expressing and purifying active Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L, and how can they be addressed?

Researchers frequently encounter several challenges when working with Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L that require specific troubleshooting approaches:

• Low expression yields: This can be addressed by optimizing codon usage for the expression host, adjusting induction conditions (temperature, inducer concentration, and timing), and selecting appropriate expression vectors with strong promoters designed for plant proteins.

• Protein insolubility: If the protein forms inclusion bodies, researchers should try expression at lower temperatures (16-20°C), co-expression with molecular chaperones, or fusion with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO.

• Loss of activity during purification: Maintain a reducing environment throughout the purification process by including reducing agents like DTT or β-mercaptoethanol in all buffers. Consider adding glycerol (10-20%) to stabilize the protein structure and prevent aggregation.

• Protein instability: Optimize buffer composition by testing various pH values, salt concentrations, and additives like glycerol. The standard Tris-based buffer with 50% glycerol has been optimized for this protein, but specific experimental conditions may require modifications .

• Inconsistent activity measurements: Standardize activity assays by using freshly prepared substrates, consistent temperature control, and carefully tracking the number of freeze-thaw cycles each protein aliquot undergoes.

• Tag interference with activity: If the recombinant tag affects enzyme activity, consider tag removal using specific proteases or design constructs with different tag positions to minimize interference with the active site.

How can researchers accurately assess enzyme kinetics and compare results across different experimental systems?

To ensure robust and comparable kinetic analyses of Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L across different experimental systems, researchers should implement the following methodological approaches:

• Standardize reaction conditions: Maintain consistent buffer compositions, pH, temperature, and ionic strength across experiments. Document and report all conditions in detail to facilitate reproduction by other laboratories.

• Employ multiple analytical techniques: Combine spectrophotometric methods (monitoring NAD(P)H consumption at 340 nm) with more specific detection methods such as HPLC analysis of reaction products or polarographic oxygen consumption measurements .

• Determine kinetic parameters systematically: Generate complete Michaelis-Menten curves by varying substrate concentrations over a wide range. Calculate and report Km, Vmax, kcat, and catalytic efficiency (kcat/Km) values using appropriate curve-fitting software.

• Account for inhibition and activation effects: Test for product inhibition, substrate inhibition, or allosteric effects by systematically varying conditions and using appropriate kinetic models to analyze the data.

• Validate with internal standards: Include well-characterized enzymes with established kinetic parameters as internal standards in comparative studies to normalize results across different experimental systems.

• Consider the redox state: Since NAD(P)H:quinone oxidoreductases are sensitive to the redox environment, carefully control and report the redox potential of your reaction system. Use redox buffers if necessary to maintain consistent conditions.

• Statistical rigor: Perform all measurements in at least triplicate, report standard errors or deviations, and apply appropriate statistical tests when comparing kinetic parameters across experimental conditions.

What are the potential applications of Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L in developing plant-based bioremediation strategies?

The unique properties of Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L suggest several promising applications in plant-based bioremediation strategies:

• Heavy metal detoxification: The enzyme's ability to catalyze quinone reduction may be leveraged to develop transgenic plants with enhanced capacity to detoxify quinone-containing pollutants in contaminated soils. Research should focus on optimizing expression levels in plant tissues that contact contaminated soil.

• Reactive oxygen species management: Building on the enzyme's potential superoxide scavenging activity (similar to human NQO1) , engineer plants with enhanced oxidative stress tolerance for remediation of sites with high levels of redox-active pollutants.

• Xenobiotic compound metabolism: Investigate the enzyme's specificity toward various environmental quinones and related compounds to identify target pollutants for bioremediation applications.

• Stress-inducible expression systems: Develop regulatory elements that increase expression of this enzyme specifically under contamination stress, creating plants that adaptively respond to pollution levels.

• Enhancement of natural hyperaccumulators: Introduce optimized versions of this enzyme into known hyperaccumulator plants to improve their tolerance to the oxidative stress associated with heavy metal accumulation.

Future research should include field trials with genetically modified plants expressing enhanced levels of this enzyme, paired with comprehensive metabolomic analyses to track the transformation of target pollutants in real-world conditions.

How might advanced understanding of plant NAD(P)H-quinone oxidoreductases contribute to the development of cancer therapeutics?

Recent research has revealed promising connections between NAD(P)H:quinone oxidoreductase 1 (NQO1) and cancer therapy, which can be extended through comparative studies with plant homologs like Barbarea verna NAD(P)H-quinone oxidoreductase subunit 4L:

• Structure-based drug design: Comparative structural analysis of plant and human enzymes can identify conserved catalytic domains and unique structural features that might be targeted for the development of specific inhibitors or activators with therapeutic potential.

• Novel substrate discovery: The plant enzyme may interact with quinone compounds not typically studied in human systems, potentially identifying new lead compounds for cancer therapy.

• Photosensitizer development: Building on the reported boron dipyrromethene-based photosensitizer that responds to human NQO1 for cancer cell elimination , researchers could use the plant enzyme to screen and develop novel enzyme-responsive photosensitizers with improved properties.

• Mechanism elucidation: Detailed understanding of how the plant enzyme scavenges superoxide and interacts with various substrates could provide insights into the mechanisms underlying the cancer-protective effects of NQO1 polymorphisms observed in human populations .

• Biosynthetic production of therapeutic compounds: Harness the plant enzyme's catalytic capabilities to produce modified quinones with enhanced anticancer properties through biocatalytic or fermentation approaches.

This cross-disciplinary approach, combining plant biochemistry with cancer research, represents an innovative pathway for identifying and developing targeted therapies that exploit the specific properties of NAD(P)H-quinone oxidoreductases.