Recombinant Barbarea verna Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Barbarea verna (Early yellowrocket) (Erysimum vernum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
CP47, a key component of the Photosystem II (PSII) core complex, plays a crucial role in chlorophyll binding and catalyzing the initial light-induced photochemical reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP production.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem II CP47 chlorophyll apoprotein (psbB) and what role does it play in photosynthesis?

Photosystem II CP47 chlorophyll apoprotein (psbB) is a core protein component of the photosystem II (PSII) complex, which is essential for the light-dependent reactions of photosynthesis. The CP47 protein functions as an internal antenna system that harvests light energy and transfers it to the reaction center of photosystem II. This protein contains multiple chlorophyll molecules and serves as a critical link in the energy transfer chain of photosynthesis. In Barbarea verna (Land cress), this protein is encoded by the chloroplast gene psbB and consists of 508 amino acids, forming a complex structure that facilitates efficient light harvesting .

The CP47 protein is also known by alternative names including "PSII 47 kDa protein" and "Protein CP-47," reflecting its approximate molecular weight of 47 kDa. Its strategic location within the PSII complex allows it to funnel excitation energy from peripheral light-harvesting complexes toward the reaction center, making it an integral component of the photosynthetic apparatus .

How does recombinant Barbarea verna psbB protein differ from native forms?

Recombinant Barbarea verna psbB protein is produced through heterologous expression systems, typically using bacterial hosts like Escherichia coli, while the native form is synthesized within the chloroplasts of B. verna plants. The recombinant form may include modifications such as affinity tags (commonly histidine tags) to facilitate purification, as seen in similar expression systems used for proteins like PsbS . These modifications can affect protein folding, stability, and functionality.

While the amino acid sequence of recombinant psbB is designed to match the native form (containing 508 amino acids as shown in search result ), post-translational modifications present in the plant-derived protein may be absent in the recombinant version. Additionally, recombinant psbB may lack proper pigment binding if not reconstituted with chlorophyll molecules, which are essential for its natural light-harvesting function in photosynthesis. These differences must be considered when interpreting experimental results obtained using recombinant versions of the protein .

What techniques are commonly used to verify the structural integrity of recombinant psbB protein?

Verification of structural integrity for recombinant psbB protein typically involves a multi-faceted approach:

  • SDS-PAGE and Western blotting - To confirm the correct molecular weight (approximately 47 kDa) and immunoreactivity using specific antibodies against the CP47 protein. This technique can be performed using polyclonal antisera similar to those used for PsbS detection .

  • Circular dichroism (CD) spectroscopy - To analyze secondary structure elements and confirm proper protein folding.

  • Fluorescence spectroscopy - To verify chlorophyll binding and assess energy transfer capability when reconstituted with pigments.

  • Size exclusion chromatography - To evaluate oligomeric state and detect potential aggregation.

  • Mass spectrometry - For precise molecular weight determination and peptide mapping to confirm the complete amino acid sequence as described in the database (UniProt ID: A4QKD1) .

Researchers should employ multiple techniques in parallel to thoroughly validate the structural integrity of recombinant psbB before proceeding with functional studies .

How do mutations in the psbB gene affect the energy transfer efficiency in photosystem II?

Mutations in the psbB gene can significantly alter energy transfer efficiency in photosystem II through multiple mechanisms. Site-directed mutagenesis studies targeting conserved amino acid residues involved in chlorophyll binding have revealed that even single amino acid substitutions can disrupt the precise spatial orientation of chlorophyll molecules, leading to altered excitation energy transfer pathways and reduced photosynthetic efficiency.

The effects of psbB mutations can be quantified through several experimental approaches:

  • Chlorophyll fluorescence measurements - Changes in variable fluorescence (Fv/Fm ratio) directly correlate with PSII efficiency, with mutations typically resulting in increased fluorescence due to impaired energy transfer.

  • Time-resolved spectroscopy - Mutations often extend the fluorescence lifetime of chlorophyll molecules, indicating less efficient energy transfer to the reaction center.

  • Oxygen evolution assays - Functional consequences of mutations can be assessed by measuring oxygen production rates, which typically decrease with impaired energy transfer.

Similar to studies with PsbS protein, where mutations at DCCD-binding sites (Glu-122 and Glu-226) were analyzed for their effects on non-photochemical quenching (NPQ), mutations in psbB can be systematically assessed for their impact on photosystem II function . These studies provide crucial insights into structure-function relationships within the PSII complex and help identify critical residues for energy transfer efficiency.

What is the relationship between psbB protein and xanthophyll-dependent non-photochemical quenching mechanisms?

The relationship between psbB protein and xanthophyll-dependent non-photochemical quenching (NPQ) mechanisms involves complex interactions within the photosystem II (PSII) supercomplex. While psbB (CP47) itself is not the primary site for NPQ, it participates in the structural organization of PSII that facilitates this protective mechanism.

Research has shown that xanthophyll-dependent NPQ primarily involves the PsbS protein and light-harvesting complex (LHC) proteins rather than psbB directly. PsbS acts as a pH-sensitive trigger for NPQ, responding to lumen acidification during high light conditions. Two competing models exist regarding the role of PsbS:

  • Direct xanthophyll binding model - Suggests PsbS directly binds xanthophylls (lutein and zeaxanthin) to facilitate quenching.

  • PsbS trigger model - Proposes PsbS acts as a conformational switch without directly binding pigments, triggering quenching in neighboring antenna proteins that bind xanthophylls .

Studies combining mutations in xanthophyll biosynthesis genes (npq1, lut2) with mutations in PsbS have demonstrated that both lutein and zeaxanthin are required for full NPQ activation, even though the direct binding of these xanthophylls to PsbS remains controversial . The CP47 protein (psbB) contributes to this process by maintaining the structural integrity of PSII and potentially influencing the orientation of antenna complexes that participate in NPQ.

What methodological approaches can resolve contradictory findings regarding pigment binding to recombinant photosystem proteins?

Resolving contradictory findings regarding pigment binding to recombinant photosystem proteins requires a multi-dimensional approach combining diverse biochemical, biophysical, and structural techniques:

  • Varied reconstitution methodologies:

    • Testing different detergent systems for protein solubilization (e.g., LDS, n-octyl β-D-glucopyranoside)

    • Exploring reconstitution under varied pH conditions (e.g., pH 7.8 vs. pH 5.5) to mimic physiological states

    • Comparing direct pigment addition versus sonication-based reconstitution methods

  • Advanced spectroscopic techniques:

    • Resonance Raman spectroscopy to detect specific pigment-protein interactions

    • Transient absorption spectroscopy to measure energy transfer kinetics

    • Circular dichroism to assess pigment-induced conformational changes

  • Controlled mutagenesis strategy:

    • Systematic mutation of predicted pigment-binding residues

    • Creation of chimeric proteins with known pigment-binding domains

    • Complementary in vivo and in vitro analysis of mutant proteins

  • Cross-validation with native proteins:

    • Direct comparison with proteins extracted from thylakoid membranes

    • Isotope labeling to distinguish native versus recombinant proteins

    • Analysis of post-translational modifications affecting pigment binding

This comprehensive approach has been successful in resolving contradictions regarding pigment binding to PsbS, where initial reports suggested direct xanthophyll binding but subsequent studies indicated PsbS might function without directly binding pigments . Similar methodologies could resolve contradictions regarding pigment binding to recombinant psbB protein.

What are optimal expression systems for producing functional recombinant psbB protein?

The selection of an appropriate expression system for producing functional recombinant psbB protein requires careful consideration of several factors:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, rapid growth, cost-effective, well-established protocolsLacks chloroplast-specific chaperones, limited post-translational modifications, inclusion body formationUse specialized strains (BL21), optimize codon usage, lower induction temperature (16-20°C), co-express chloroplast chaperones
Chlamydomonas reinhardtiiNative-like chloroplast environment, appropriate post-translational modificationsLower yield, longer cultivation time, more complex genetic manipulationOptimize light conditions, use inducible promoters, create knockout strains of competing proteins
Tobacco chloroplast transformationIn vivo assembly with native cofactors, appropriate post-translational environmentTime-consuming, specialized transformation techniques requiredUse strong chloroplast promoters, optimize codon usage for chloroplast expression, control light exposure
Cell-free systemsAvoid toxicity issues, direct manipulation of reaction environmentHigher cost, lower yield, requires pre-purified componentsSupplement with chlorophyll precursors, add liposomes for membrane protein folding, optimize redox conditions

How can researchers effectively reconstitute recombinant psbB with chlorophyll and other cofactors?

Effective reconstitution of recombinant psbB with chlorophyll and other cofactors requires a careful stepwise approach:

  • Protein preparation phase:

    • Purify recombinant protein under mild denaturing conditions using affinity chromatography (e.g., nickel immobilized methyl affinity chromatography for His-tagged proteins)

    • Remove detergents like SDS or Triton X-100 through dialysis or precipitation methods

    • Transition to milder detergents such as n-octyl β-D-glucopyranoside (1%) that maintain protein solubility while enabling cofactor binding

  • Cofactor preparation:

    • Extract and purify chlorophyll a and b from plant tissue using acetone extraction followed by HPLC purification

    • Prepare cofactor mixtures in organic solvents compatible with the reconstitution buffer

    • Determine optimal chlorophyll a/b ratios through preliminary experiments

  • Reconstitution methodology:

    • Implement a gradual detergent removal approach using either dialysis or cyclodextrin-based methods

    • Test both direct mixing and sonication-based protocols at different pH values (e.g., pH 7.8 for neutral conditions and pH 5.5 to mimic thylakoid lumen during light stress)

    • Monitor the reconstitution process through absorption spectroscopy to track chlorophyll binding

  • Verification of successful reconstitution:

    • Analyze pigment-protein complexes using sucrose gradient ultracentrifugation

    • Verify energy transfer through fluorescence emission spectra and lifetime measurements

    • Confirm structural integrity through circular dichroism spectroscopy

This approach is adaptable from protocols used for other photosystem components, such as those described for PsbS protein reconstitution experiments , with modifications specific to the chlorophyll-binding properties of psbB protein.

What analytical techniques best characterize the functional properties of reconstituted psbB protein?

Characterization of reconstituted psbB protein functionality requires a comprehensive analytical approach addressing multiple aspects of protein performance:

  • Spectroscopic analyses for pigment-protein interactions:

    • Absorption spectroscopy (350-750 nm) to verify chlorophyll binding through characteristic red shifts compared to free chlorophyll

    • Circular dichroism to assess pigment organization and protein secondary structure

    • Fluorescence excitation and emission spectra to evaluate energy transfer efficiency

    • Time-resolved fluorescence to measure energy transfer kinetics

  • Biochemical assessment of complex formation:

    • Blue native PAGE to analyze formation of higher-order complexes

    • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) for precise molecular weight determination

    • Crosslinking mass spectrometry to identify protein-protein interaction interfaces

  • Functional assays:

    • Reconstitution into liposomes followed by measurement of light-induced electron transfer

    • Oxygen evolution measurements when combined with other PSII components

    • Transient absorption spectroscopy to track energy and electron transfer events

  • Structural analyses:

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamic regions and conformational changes

    • Single-particle cryo-electron microscopy for structural determination

    • Molecular dynamics simulations based on experimental data to model energy transfer pathways

These analytical approaches should be applied in concert, as demonstrated in studies of PsbS function , to build a comprehensive understanding of how reconstituted psbB contributes to photosystem II function. Each technique provides complementary insights, and their combined application helps overcome limitations inherent to individual methods.

How can insights from Barbarea verna psbB studies be applied to improve photosynthetic efficiency in crop plants?

Research on Barbarea verna psbB provides valuable insights that can be translated to crop improvement strategies through several pathways:

  • Engineering optimized psbB variants:

    • Targeted amino acid substitutions based on B. verna psbB sequence analysis could enhance chlorophyll binding or improve energy transfer efficiency

    • Creation of chimeric psbB proteins incorporating beneficial features from B. verna and crop species could optimize light harvesting under specific environmental conditions

    • CRISPR-Cas9 mediated editing of crop psbB genes to match beneficial B. verna variants

  • Exploiting natural defense mechanisms:

    • B. verna produces specialized metabolites like nasturlexins C and D with antifungal activity against crucifer pathogens Alternaria brassicicola, Leptosphaeria maculans, and Sclerotinia sclerotiorum

    • These defense pathways could be transferred to agriculturally important crops within the Brassica species, potentially reducing yield losses from fungal diseases

    • Integration of photosynthetic efficiency and pathogen resistance strategies could create crop varieties with both enhanced productivity and resilience

  • Improving stress tolerance:

    • Analysis of how B. verna psbB functions under environmental stress conditions could inform strategies for enhancing crop photosynthesis during drought, heat, or high light stress

    • Engineering improved interactions between psbB and proteins involved in photoprotection (like PsbS) could enhance non-photochemical quenching responses in crops

    • Modulation of xanthophyll-protein interactions based on B. verna models could optimize energy dissipation under fluctuating light conditions

These translational approaches align with findings that B. vulgaris and B. verna "have great potential as sources of defense pathways transferable to agriculturally important crops within the Brassica species" , extending this potential to photosynthetic efficiency traits as well.

What role does psbB play in the interaction between photosynthesis and plant defense responses?

The psbB protein functions at the intersection of photosynthesis and plant defense through multiple interconnected mechanisms:

  • Metabolic resource allocation:

    • As a core component of photosystem II, psbB influences photosynthetic efficiency and consequently the energy available for defense compound synthesis

    • Under pathogen stress, plants must balance resources between maintaining photosynthesis and producing defensive metabolites like nasturlexins

  • Reactive oxygen species (ROS) signaling:

    • Photosystem II is a major site of ROS production in chloroplasts

    • psbB functionality affects ROS generation, which serves as a signaling mechanism in defense responses

    • Controlled ROS production can trigger systemically acquired resistance and phytoalexin biosynthesis

  • Chloroplast retrograde signaling:

    • Changes in psbB function or abundance alter chloroplast redox state

    • This generates retrograde signals to the nucleus that can modify expression of defense-related genes

    • The induced defense compounds in B. verna, including nasturlexins C and D and their sulfoxides, display antifungal activity against crucifer pathogens

  • Metabolic integration:

    • The biosynthetic pathways for photosynthetic pigments and certain defense compounds share precursors

    • Research on B. verna has revealed potential bioactive compounds that could influence both photosynthetic performance and pathogen resistance

    • The cruciferous phytoalexins identified in B. verna suggest metabolic pathways that could be exploited for dual enhancement of photosynthesis and defense

This integrated understanding explains why plants with optimized photosynthetic machinery, including properly functioning psbB protein, often demonstrate enhanced resilience against pathogen challenges, creating opportunities for breeding crops with both high productivity and robust defense systems.

What emerging technologies might advance our understanding of psbB function in dynamic photosynthetic processes?

Several cutting-edge technologies are poised to transform our understanding of psbB function in photosynthesis:

  • Advanced imaging techniques:

    • Single-molecule localization microscopy (SMLM) for tracking psbB dynamics within thylakoid membranes at nanometer resolution

    • Cryo-electron tomography to visualize native arrangements of photosystem II complexes within intact thylakoids

    • Correlative light and electron microscopy (CLEM) to connect protein function with ultrastructural features

  • High-temporal resolution spectroscopy:

    • Ultrafast transient absorption spectroscopy with femtosecond resolution to track energy transfer events through psbB

    • Two-dimensional electronic spectroscopy to map energy pathways and quantum coherences

    • In situ spectroscopic methods for monitoring protein function under physiologically relevant conditions

  • Synthetic biology approaches:

    • Designer photosystem II complexes with non-natural amino acids incorporated into psbB for novel functionality

    • Minimal synthetic photosystems to define essential components for efficient function

    • Optogenetic control of psbB expression or modification to probe dynamic assembly processes

  • Computational methods:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations to model energy transfer with quantum effects

    • Machine learning algorithms to predict structure-function relationships from large datasets

    • Systems biology modeling integrating psbB function with whole-plant physiology

  • In vivo manipulation techniques:

    • Expansion of CRISPR-Cas systems for precise chloroplast genome editing

    • Nanobody-based approaches for selective inhibition or tracking of psbB in living cells

    • Optogenetic tools for controlling protein-protein interactions involving psbB with light

These technologies promise to resolve current contradictions in photosystem research, such as the debate over xanthophyll binding to PsbS , by providing unprecedented spatial, temporal, and mechanistic resolution of photosynthetic processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.