Recombinant Barley stripe mosaic virus Movement protein TGB2

What is the structural composition of BSMV TGB2 protein?

BSMV TGB2 is a 131 amino acid protein containing two predicted transmembrane helices with N and C termini located in the cytoplasm . The protein sequence (AA Sequence: MKTTVGSRPNKYWPIVAGIGVVGLFAYLIFSNQKHSTESGDNIHKFANGGSYRDGSKSISYNRNHPFAYGNASSPGMLLPAMLTIIGIISYLWRTRDSVLGDSGGNNSCGEDCQGECLNGHSRRSLLCDIG) includes a conserved hydrophilic motif (G-G-x-Y-R/K-D-G) in the intervening loop between the transmembrane domains . This structural arrangement is characteristic of Group 1 and Group 2 TGB-containing viruses, where TGB2 functions as a membrane-associated protein essential for viral movement .

How does recombinant BSMV TGB2 protein function in viral movement?

BSMV TGB2 functions as part of a coordinated system with TGB1 and TGB3 proteins to facilitate cell-to-cell movement of the virus . Methodologically, TGB2 acts as an endomembrane anchor that binds viral ribonucleoprotein (RNP) complexes to direct their transport to plasmodesmata . Research has demonstrated that TGB2 predominantly localizes to the endoplasmic reticulum (ER) initially, followed by association with motile granules and vesicles . Unlike TGB1, which can move cell-to-cell independently, TGB2 facilitates movement but is not itself transported between cells due to its strong association with cellular membranes .

What expression systems are typically used for producing recombinant BSMV TGB2 protein?

Recombinant BSMV TGB2 protein is typically expressed in E. coli systems with an N-terminal His tag for purification purposes . The methodological approach involves amplifying the TGB2 sequence from BSMV β42SpI cDNA clone, inserting it into an appropriate expression vector, and expressing the protein in E. coli . For research requiring visualization of the protein in plant cells, expression is often achieved through Agrobacterium tumefaciens-mediated protein expression in Nicotiana benthamiana leaf cells or through the use of viral vectors such as Tobacco mosaic virus (TMV)-based vectors .

What is the subcellular localization pattern of BSMV TGB2 during viral infection?

BSMV TGB2 displays a dynamic localization pattern during viral infection. Initially, fluorescently tagged TGB2 (GFP-TGB2 or mRFP-TGB2) labels the endoplasmic reticulum network and membranes surrounding the nucleus . As infection progresses, TGB2 forms motile bodies and vesicle-like structures (0.5-4 μm in size) that move within the cell . These vesicles are often associated with the plasma membrane and appear to bud from it at discrete locations in the cell periphery . Many vesicles move via cytoplasmic streaming and become closely associated with the nuclear envelope . Methodologically, this localization pattern has been characterized using confocal laser-scanning microscopy of fluorescently tagged TGB2 proteins expressed in plant epidermal cells .

How does the ratio of TGB2 to TGB3 affect their subcellular localization?

The relative expression levels of TGB2 and TGB3 significantly influence their cytosolic and cell wall distributions . Experimental approaches have shown that by testing different ratios of GFP-TGB2 to TGB3, researchers can assess the influence of their relative abundances on TGB2 localization . When co-expressed with TGB3, TGB2 is redirected from the ER to the cell wall, indicating that TGB3 plays a crucial role in TGB2 targeting . This interaction is functionally important, as deviations from optimal TGB protein ratios impair viral movement . Methodologically, these relationships have been studied using plasmids designed for individual expression of TGB proteins and through co-expression experiments using Agrobacterium-mediated transient expression .

What role does the endocytic pathway play in BSMV TGB2 trafficking?

Research has revealed that BSMV TGB2 traffics through the endocytic pathway during viral movement . TGB2-containing vesicles are labeled with FM4-64, a marker for plasma membrane internalization and components of the endocytic pathway . Additionally, TGB2 colocalizes in vesicles with Ara7, a Rab5 ortholog that marks the early endosome . Protein interaction analysis has shown that recombinant TGB2 interacts with a tobacco protein belonging to the highly conserved RME-8 family of J-domain chaperones, which are essential for endocytic trafficking in other organisms . Methodologically, these endocytic associations have been determined through co-localization studies with specific markers and through protein interaction analysis .

How does TGB2 interact with other viral proteins in the BSMV movement complex?

TGB2 engages in multiple protein-protein interactions within the BSMV movement complex. It interacts directly with TGB3, which redirects TGB2 from the ER to the cell wall . The TGB1-TGB3-TGB2 complex formation is enhanced by ATP hydrolysis, suggesting a mechanistic role for the TGB1 ATPase activity in complex assembly . Additionally, immunoprecipitation experiments have revealed that the γb protein interacts with TGB1 in these complexes . The N-terminus of γb interacts with the TGB1 ATPase/helicase domain and enhances the ATPase activity . Methodologically, these interactions have been studied using co-immunoprecipitation, chemical cross-linking, and yeast two-hybrid approaches .

What methodologies are most effective for studying TGB2 protein-protein interactions?

Multiple complementary methodologies have proven effective for studying TGB2 interactions:

• Co-immunoprecipitation (co-IP): Particularly useful for detecting in vivo interactions, co-IP has been employed to identify TGB1-TGB3-TGB2 complex formation and its enhancement by ATP hydrolysis .

• Chemical cross-linking: Using agents like tripeptide GlyGlyHis has allowed researchers to stabilize transient protein-protein interactions involving TGB2 .

• Fluorescence microscopy: Co-localization studies using differentially tagged proteins (e.g., mRFP-TGB2 and GFP-TGB3) have revealed spatial relationships between TGB proteins in plant cells .

• In vitro translation systems: Combined with co-IP analysis, this approach has been valuable for studying the ATP-dependence of complex formation between TGB proteins .

• Agrobacterium-mediated protein expression: This system allows for transient expression of TGB proteins in plant cells to study their localization and interactions under various conditions .

These methodologies have collectively contributed to our understanding of how TGB2 functions within the viral movement complex.

What is the functional significance of TGB2 interaction with the endocytic pathway components?

The interaction of TGB2 with endocytic pathway components suggests a novel mechanism for viral intracellular movement . TGB2 interacts with proteins from the RME-8 family of J-domain chaperones, which are essential for endocytic trafficking . This interaction may allow the virus to exploit host endocytic machinery for intracellular movement of viral RNA. The association of TGB2 with early endosomes (marked by Ara7) further supports this hypothesis . Functionally, this interaction might represent an evolutionary adaptation that allows viruses to utilize pre-existing cellular pathways for their movement. Methodologically, this significance has been established through protein interaction studies and co-localization with endocytic markers in living cells .

How do mutations in TGB2 affect viral movement and protein localization?

Mutations in TGB2 can significantly impair viral cell-to-cell movement, highlighting its essential role in this process . Research has shown that site-specific mutagenesis affecting TGB2's ability to interact with TGB3 prevents proper targeting to the cell wall and impairs virus movement . A table summarizing key TGB2 mutations and their effects includes:

Methodologically, these effects have been studied using site-specific mutagenesis followed by expression in plant cells and assessment of both protein localization and viral movement capabilities .

What is the relationship between BSMV TGB2 and chloroplast targeting during viral infection?

While TGB2 itself primarily associates with the ER and derived vesicles, research has revealed intriguing connections with chloroplast-based viral processes . BSMV replication is associated with vesicles in proplastids and chloroplasts , and TGB2 may play a role in delivering viral components to these replication sites. The γb protein, which interacts with the TGB movement complex, localizes to chloroplasts in virus-infected cells and is involved in chloroplast-based replication processes . Recent research has shown that γb disrupts chloroplast antioxidant defenses to create an oxidative microenvironment conducive to viral replication . Methodologically, these relationships have been investigated using subcellular fractionation, electron microscopy of thin sections from infected leaves, and localization studies with fluorescently tagged proteins .

How do the hordei-like and potex-like TGB2 proteins differ in their functions and interactions?

TGB proteins are classified into two groups: hordei-like (found in hordeiviruses like BSMV) and potex-like (found in potexviruses) . Key differences include:

• Requirement for coat protein: Group 1 (hordei-like) viruses do not require coat protein for cell-to-cell movement, whereas Group 2 (potex-like) viruses do require it .

• Composition of movement complex: In hordei-like viruses, the movement complex is a non-virion ribonucleoprotein complex, while in potex-like viruses, it may involve intact virions or a different form of RNP .

• Cell-to-cell movement mechanisms: The TGB1 proteins of both groups can move cell-to-cell independently, but their interactions with TGB2 and TGB3 differ in terms of targeting and complex formation .

• ATPase activity requirements: Both groups require TGB1 ATPase activity for proper targeting, but the specific interactions with other viral proteins differ .

Methodologically, these differences have been elucidated through comparative studies of protein targeting, mutagenesis of conserved motifs, and analysis of movement complex formation in different viral systems .

How does the ATP-dependent enhancement of TGB complex formation relate to endocytic trafficking?

Recent research suggests intriguing connections between ATP-dependent processes and endocytic trafficking in TGB-mediated viral movement . The TGB1-TGB3-TGB2 complex formation is enhanced by ATP hydrolysis via the TGB1 ATPase activity . Concurrently, TGB2 interacts with components of the endocytic pathway, which typically requires energy in the form of ATP for vesicle formation and trafficking . A comprehensive model would suggest that TGB1's ATPase activity might provide energy for both complex assembly and endocytic trafficking of the viral movement complex. Methodologically, this relationship could be further investigated using ATP depletion studies, ATPase inhibitors, or mutations in the TGB1 ATPase domain combined with endocytic trafficking assays .

What contradictory findings exist regarding TGB2 localization at plasmodesmata?

The literature presents some contradictions regarding TGB2 localization at plasmodesmata:

• Some studies report that GFP-TGB2 does not label plasmodesmata when expressed from TMV vectors in Nicotiana benthamiana epidermal cells .

• Other research indicates that TGB2 targeting to the cell wall is dependent on interactions with TGB3, which itself localizes to plasmodesmata .

• When co-bombarded with GFP-TGB3, mRFP-TGB2 does not associate with punctae representing plasmodesmata but forms dual-labeled stationary structures at the cell periphery .

These apparent contradictions might reflect differences in experimental approaches, expression levels, or the presence of other viral components. Methodologically, resolving these contradictions would require standardized approaches using consistent expression systems and careful quantification of protein localization patterns under various conditions .

What are the latest findings on the role of TGB2 in counteracting host defense mechanisms?

While TGB2's primary characterized function relates to viral movement, emerging research suggests potential roles in host defense evasion:

• TGB2's association with the endocytic pathway may help viruses evade host surveillance mechanisms that monitor cell surface dynamics .

• Recent research on the γb protein, which interacts with the TGB movement complex, has revealed its role in disrupting chloroplast antioxidant defenses by interacting with NADPH-dependent thioredoxin reductase C (NTRC) .

• The TGB complex may contribute to creating microenvironments favorable for viral replication while shielding viral RNA from host defense mechanisms .

Methodologically, investigating these aspects would require comprehensive approaches combining protein-protein interaction studies, gene silencing experiments, and analysis of reactive oxygen species during infection with wild-type and mutant viruses lacking functional TGB2 .