Recombinant Barley stripe mosaic virus Movement protein TGB3

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Movement protein TGB3; 17 kDa protein; Beta-C protein; Triple gene block 3 protein; TGBp3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Barley stripe mosaic virus (BSMV)
Target Protein Sequence
MAMPHPLECCCPQCLPSSESFPIYGEQEIPCSETQAETTPVEKTVRANVLTDILDDHYYA ILASLFIIALWLLYIYLSSIPTETGPYFYQDLNSVKIYGIGATNPEVIAAIHHWQKYPFG ESPMWGGLISVLSILLKPLTLVFALSFFLLLSSKR
Uniprot No.

Target Background

Function
This protein participates in viral genome transport to adjacent plant cells directly via plasmodesmata, bypassing budding. TGBp2 and TGBp3 are essential for intracellular delivery of TGBp1-containing viral ribonucleoprotein complexes (vRNPs) to plasmodesmata (likely). It can modulate plasmodesmata gating and increase their size exclusion limit. Furthermore, it induces thickening of the host actin cytoskeleton network, which likely plays a crucial role in cell-to-cell viral movement.
Database Links

KEGG: vg:962679

Protein Families
Virgaviridae TGB3 movement protein family
Subcellular Location
Host cell junction, host plasmodesma. Host endoplasmic reticulum membrane; Multi-pass membrane protein. Host cytoplasm, host cytoskeleton.

Q&A

What is the basic structure and function of the BSMV TGB3 protein?

TGB3 is a membrane-associated movement protein encoded by the overlapping triple gene block (TGB) of BSMV. Structurally, TGB3 contains two transmembrane domains that integrate into membranes in a U-shaped orientation with its central loop protruding into the endoplasmic reticulum (ER) lumen . Functionally, TGB3 is essential for cell-to-cell movement of BSMV in both monocot and dicot hosts, working in coordination with TGB1 and TGB2 proteins .

The protein localizes at the cell wall in close association with plasmodesmata, forming punctate foci at calcofluor-stained walls when expressed alone . This localization pattern is critical for its movement function, as it assists in targeting viral ribonucleoprotein complexes to the plasmodesmata for intercellular transport.

How do the TGB proteins of BSMV interact during viral movement?

The three TGB proteins work in a coordinated manner to facilitate viral intercellular movement through multiple protein-protein interactions:

  • TGB1-TGB3 interactions: TGB1 directly binds to TGB3 as demonstrated by affinity chromatography and yeast two-hybrid experiments . This interaction is important for cell-to-cell movement of the virus.

  • TGB2-TGB3 interactions: TGB2 and TGB3 form heterologous interactions that require specific residues - the TGB2 glycine 40 and the TGB3 isoleucine 108 . These interactions are necessary for BSMV movement, as mutations affecting these residues prevent cell-to-cell spread.

  • TGB1 self-interactions: TGB1 engages in homologous interactions leading to the formation of a ribonucleoprotein complex containing viral genomic and messenger RNAs .

The relative expression levels of TGB2 and TGB3 influence the cytosolic and cell wall distributions of TGB1 and TGB2, with optimal localization at the cell wall requiring balanced expression of all three proteins .

What subcellular compartments does BSMV TGB3 associate with during infection?

BSMV TGB3 associates with multiple subcellular compartments during infection:

  • Cell wall/plasmodesmata: TGB3 localizes at the cell wall in close association with plasmodesmata, which is critical for facilitating viral movement between cells .

  • Endoplasmic reticulum (ER): TGB3 associates with ER membranes, consistent with its role as a membrane protein .

  • Motile granules: TGB3 has been observed in motile granules in the cytoplasm, which may represent transport vesicles involved in protein trafficking .

The protein's ability to associate with these different compartments is integral to its function in coordinating the intracellular movement of viral components toward and through plasmodesmata.

How do mutations in the C-terminus of TGB3 affect its function and localization?

The C-terminus of BSMV TGB3 is critical for proper protein function and subcellular localization. Confocal microscopy studies have revealed that the deletion or mutagenesis of a single amino acid at the immediate C-terminus can significantly affect cell wall targeting . This impaired targeting correlates with diminished cell-to-cell movement capacity of the virus.

For experimental approaches to study C-terminal mutations:

  • Site-directed mutagenesis: Target specific residues in the C-terminus using overlap extension PCR methods similar to those used for TGB2 and TGB3 mutant derivatives .

  • Subcellular localization analysis: Use Agrobacterium tumefaciens-mediated protein expression in Nicotiana benthamiana leaf cells coupled with confocal microscopy to visualize protein localization patterns .

  • Movement assays: Evaluate the ability of viruses containing TGB3 C-terminal mutations to establish local lesions in Chenopodium amaranticolor or systemic infections in appropriate hosts .

What methodologies are most effective for studying TGB3 protein interactions in vitro and in vivo?

Multiple complementary techniques have proven effective for investigating TGB3 interactions:

In vitro methods:

  • Affinity chromatography: Used successfully to demonstrate TGB1-TGB3 binding .

  • Co-immunoprecipitation (co-IP): Effective for detecting protein complexes, as demonstrated with TGB1-TGB3-TGB2 complex formation in the presence of ATP .

  • In vitro translation: Combined with co-IP to analyze complex formation under different conditions (e.g., with/without ATP) .

In vivo methods:

  • Yeast two-hybrid assays: Critical for confirming protein-protein interactions, as shown in Table 1 of source , which outlines primers and cloning strategies for creating yeast two-hybrid constructs.

  • Bimolecular fluorescence complementation (BiFC): Though not explicitly mentioned in the search results, this technique is commonly used to visualize protein interactions in plant cells.

  • Fluorescent protein fusions and confocal microscopy: The GFP-TGB1 fusion approach has been successful in tracking protein localization during infection .

Clone5′ Oligonucleotide3′ OligonucleotideChange(s) and/or source
pGAD:TGB1NANone (WT); from Bragg et al., 2003
β-TGB2 G40R,D41RTGB2NcoIF, TGCCCATGGGGATGAAGACCACACAGTTGGTGB2PflmIR, AGAGCCAATGATATGGAGACTAGCCAATG40R and D41R
β-TGB3 P105R,I108RTGB3NcoIF, TGCCCATGGCAATGCCTCATCCCCTGGATGB3PflmIR, ACACTCCATCATATGGTTGATGGP105R and I108R

Table 1: Example primer sets and constructs for studying TGB protein interactions

How does the coordination between TGB3 and TGB2 affect subcellular localization and viral movement?

The coordination between TGB3 and TGB2 is critical for proper subcellular targeting and viral movement:

  • Redirected localization: TGB3 directs the localization of TGB2 from the endoplasmic reticulum to the cell wall, and this targeting depends on specific interactions between the TGB2 and TGB3 proteins .

  • Mutation effects: BSMV mutants containing amino acid substitutions in TGB2 glycine 40 or TGB3 isoleucine 108 are unable to move from cell to cell, indicating these residues are crucial for functional TGB2-TGB3 interactions .

  • Expression balance: The relative expression levels of TGB2 and TGB3 influence the cytosolic and cell wall distributions of both TGB1 and TGB2. Substantial deviations from the wild-type TGB protein ratios compromise movement efficiency .

To experimentally investigate this coordination:

  • Create recombinant BSMV variants with mutations in TGB2-TGB3 interaction domains

  • Use fluorescent protein fusions to simultaneously track both proteins

  • Employ time-lapse imaging to analyze the dynamics of their co-localization during infection

How does phosphorylation affect TGB3 function in viral movement?

While specific information about BSMV TGB3 phosphorylation is limited in the search results, insights from related viruses like Potato mop-top virus (PMTV) suggest important regulatory roles:

  • Interaction regulation: In PMTV, the phosphorylation/dephosphorylation state of TGB3 affects the intensity of its interaction with TGB2. Mutations of tyrosine residues (e.g., Tyr-87, Tyr-88, Tyr-89) to alanine enhance the interaction between TGB3 and TGB2 in yeast .

  • Infection impact: Although the TGB3Y120A mutant of PMTV doesn't affect interaction with TGB2 protein, it cannot infect N. benthamiana, demonstrating that specific phosphorylation sites are crucial for viral infection independent of their effects on protein interactions .

To study TGB3 phosphorylation in BSMV:

  • Identify potential phosphorylation sites using bioinformatics tools

  • Create phosphomimetic and phosphodeficient mutants

  • Perform in vitro phosphorylation assays with candidate kinases

  • Analyze the effects of these mutations on protein localization and viral movement

What role does the γb protein play in BSMV TGB3-mediated movement?

The γb protein of BSMV functions as a novel positive regulator of viral cell-to-cell movement, though it interacts primarily with TGB1 rather than directly with TGB3:

  • TGB1 interaction: The γb protein directly interacts with TGB1 both in vitro and in vivo . This interaction involves the N-terminus of γb binding to the TGB1 ATPase/helicase domain.

  • Enhanced ATPase activity: γb enhances the ATPase activity of TGB1's helicase domain, which is critical for movement as inactivation of TGB1 ATPase activity significantly impairs plasmodesmata targeting .

  • Complex formation regulation: The γb protein positively regulates the formation of movement complexes in the presence of ATP. Specifically, it enhances TGB1-TGB3-TGB2 complex formation, suggesting an indirect effect on TGB3 function through its interaction with TGB1 .

  • Subcellular localization: γb localizes to various cellular structures during infection, including chloroplasts, ER, actin filaments, and plasmodesmata, potentially facilitating the coordination of movement complex assembly at different stages .

While not essential for movement, γb significantly enhances its efficiency, making it an important factor to consider when studying TGB3's role in viral movement.

How do the structural features of TGB3 differ between hordeiviruses and other TGB-containing viruses?

TGB proteins are found in nine genera of viruses across five different families, with TGB modules falling into two classes: hordei-like (as in BSMV) and potex-like . Comparative analysis reveals:

  • Membrane association: In both BSMV (a hordeivirus) and PMTV (a pomovirus), TGB3 is membrane-associated with two hydrophobic membrane-spanning domains .

  • Plasmodesmatal targeting: PMTV TGB3 contains a conserved tyrosine-based motif that mediates plasmodesmatal targeting . BSMV TGB3 also localizes to plasmodesmata, though the specific targeting motif is less well characterized in the search results.

  • Functional requirements: While TGB3 alone appears sufficient to assist TGB1 in intercellular transport of BSMV (with TGB2 increasing efficiency) , in other viruses like PMTV, the TGB3Y120A mutant cannot infect plants despite maintaining TGB2 interaction capability .

To experimentally study these differences:

  • Create chimeric TGB3 proteins combining domains from different virus groups

  • Perform complementation assays to test functional interchangeability

  • Use structural biology approaches to resolve the three-dimensional organization of these proteins

What are the most effective systems for expressing recombinant BSMV TGB3 for functional studies?

Several expression systems have proven effective for studying BSMV TGB3:

  • Agrobacterium-mediated expression: Agrobacterium tumefaciens-mediated protein expression in Nicotiana benthamiana leaf cells has been successfully used for subcellular localization studies and protein interaction analyses .

  • Viral vectors: Engineering GFP fusions within viral genomes has allowed tracking of TGB proteins during authentic infection. For example, a GFP-TGB1 fusion was created that maintained the ability to move from cell to cell and establish local lesions in Chenopodium amaranticolor and systemic infections in N. benthamiana and barley .

  • Yeast expression: Yeast systems have been used for two-hybrid analyses of TGB protein interactions .

For experimental design considerations:

  • When creating TGB3 constructs, use primers similar to those documented in the literature, such as TGB3NcoIF (TGCCCATGGCAATGCCTCATCCCCTGGA) and TGB3PflmIR (ACACTCCATCATATGGTTGATGG)

  • For mutation studies, employ overlap extension PCR methods as demonstrated in previous TGB2 and TGB3 mutant derivative work

  • Consider expression timing and protein abundance, as substantial deviation from wild-type TGB protein ratios can compromise movement functions

How can researchers effectively visualize and track TGB3 movement and localization during infection?

Visualization of TGB3 during infection requires specialized techniques:

  • Fluorescent protein fusions: Creating fusions with GFP or other fluorescent proteins has been successful for tracking TGB proteins. Care must be taken to ensure the fusion doesn't compromise protein function .

  • Time-course imaging: The GFP-TGB1 fusion exhibited a temporal pattern of expression along the advancing edge of the infection front, suggesting similar approaches would be valuable for TGB3 .

  • Co-localization with cellular markers: Use of calcofluor for cell wall staining has helped identify TGB3 association with plasmodesmata . Additional markers for ER, actin cytoskeleton, and other cellular structures would provide comprehensive localization data.

  • Live-cell imaging: For dynamic studies of protein movement, confocal microscopy of living infected tissue can reveal the temporal aspects of TGB3 trafficking.

Experimental approach recommendations:

  • Use multiple fluorescent protein tags to simultaneously track different TGB proteins

  • Combine with immunogold labeling for electron microscopy studies of precise subcellular localization

  • Employ photoactivatable or photoconvertible fluorescent proteins to track protein movement from specific cellular locations

What methodological approaches are most effective for studying the ATP-dependent aspects of TGB3 function in movement complexes?

The role of ATP in TGB protein functions, particularly related to TGB3's participation in movement complexes, can be studied through several approaches:

  • In vitro ATPase assays: These can measure how TGB3 affects the ATPase activity of TGB1, similar to studies showing that γb enhances TGB1 ATPase activity .

  • ATP-dependent complex formation: In vitro translation coupled with co-immunoprecipitation has revealed that TGB1-TGB3-TGB2 complex formation is enhanced by ATP hydrolysis . This approach can be modified to specifically study TGB3's role.

  • Site-directed mutagenesis: Creating mutations in the TGB1 ATPase/helicase domain has shown that inactivation of TGB1 ATPase activity significantly impairs plasmodesmata targeting . Similar approaches can explore how these mutations affect TGB3 interactions.

  • ATP analogs: Using non-hydrolyzable ATP analogs in binding and complex formation assays can help distinguish between ATP binding and hydrolysis requirements.

For experimental designs:

  • Include appropriate controls with ATP, ADP, and non-hydrolyzable ATP analogs

  • Consider ATP concentration gradients to establish dose-dependent effects

  • Combine with fluorescence recovery after photobleaching (FRAP) to examine how ATP affects the dynamics of TGB3 movement in living cells

How do the TGB3 proteins of BSMV compare with those of other viruses in the hordei-like TGB class?

The TGB3 proteins across the hordei-like TGB class share several features but also display important differences:

To experimentally address these comparisons:

  • Perform sequence and structural alignments of TGB3 proteins from multiple hordei-like TGB viruses

  • Create chimeric proteins to test functional domain conservation

  • Use comparative phosphoproteomics to identify conserved modification sites

What insights can be gained from studying TGB3 in different host plants?

BSMV can infect both monocot and dicot hosts, providing valuable comparative insights:

  • Host-specific requirements: BSMV TGB3 is required for cell-to-cell movement in both monocot and dicot hosts , but the efficiency and specific interactions may vary between host systems.

  • Experimental systems: Studies have used various hosts including barley (Hordeum vulgare, a natural host), Nicotiana benthamiana (a common experimental host), and Chenopodium amaranticolor (used for local lesion assays) .

  • Cell biology differences: The architecture of plasmodesmata and cell walls differs significantly between monocots and dicots, potentially affecting TGB3 function.

Research approaches for comparative host studies:

  • Perform parallel localization studies in monocot and dicot hosts

  • Compare the kinetics of viral movement in different host systems

  • Identify host proteins that interact with TGB3 in different plant species

  • Create host-specific mutations to test adaptation hypotheses

What emerging technologies could advance our understanding of BSMV TGB3 function?

Several cutting-edge approaches could significantly enhance TGB3 research:

  • Cryo-electron microscopy: Determining the three-dimensional structure of TGB3 alone and in complex with other movement proteins could provide crucial insights into function.

  • Single-molecule tracking: Following individual TGB3 molecules in living cells would reveal dynamic aspects of trafficking and interactions.

  • Temporal Graph Benchmark (TGB) analysis: Though unrelated to the Triple Gene Block (same acronym), the computational approaches described in reference for analyzing temporal graphs could be adapted to model the dynamic interactions of viral movement proteins over time during infection .

  • CRISPR-based approaches: Editing host factors that interact with TGB3 could reveal new aspects of movement protein biology.

  • Synthetic biology: Creating minimal synthetic systems that reconstitute TGB3 function could determine the essential components required for movement.

These approaches would complement existing methods and potentially resolve current contradictions in our understanding of TGB3 function.

How might TGB3 research contribute to broader understanding of viral movement mechanisms?

Research on BSMV TGB3 has implications for understanding fundamental aspects of plant virus biology:

  • Conserved mechanisms: The TGB module is found in nine genera of viruses across five different families , making insights from BSMV TGB3 potentially applicable to a broad range of plant viruses.

  • Membrane protein trafficking: TGB3's role in directing protein localization from the ER to plasmodesmata provides a model for studying general principles of membrane protein trafficking in plants.

  • Host-pathogen interactions: Understanding how TGB3 interacts with host cellular machinery can reveal aspects of cell biology that are exploited by diverse pathogens.

  • Movement complex assembly: The coordinated assembly of movement complexes involving TGB3 exemplifies a complex biological process requiring precise spatial and temporal regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.