Recombinant Bartonella bacilliformis ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Role of ATP Synthase Subunit a (atpB) in Bacterial Energy Metabolism

ATP synthase is a membrane-bound enzyme responsible for ATP synthesis via oxidative phosphorylation. Subunit a (encoded by atpB) is a core component of the Fo region, facilitating proton translocation across the membrane to drive ATP production . In B. bacilliformis, this subunit likely contributes to:

  • Proton channel formation: Critical for coupling proton motive force to ATP synthesis .

  • Structural integrity: Stabilizes interactions between the c-ring and other Fo subunits .

  • Pathogenicity: ATP synthase is essential for bacterial survival, making it a potential drug target .

Production and Characterization of Recombinant atpB

While B. bacilliformis atpB is not explicitly detailed in the provided sources, recombinant production methods for homologous proteins (e.g., Bartonella tribocorum atpB) offer a template :

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Amino Acid Sequence252 residues (e.g., MTAHAPDPIHQFEVSRLIKISIGNMDLSFTNVSLFTVVTVVITAAFLFISSSSR...)
Purity>90% (SDS-PAGE verified)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)

Key Challenges:

  • Instability during purification due to transmembrane domain hydrophobicity .

  • Need for detergents or lipid mimetics to maintain structural integrity .

4.1. Drug Target Identification

Subunit a is prioritized in B. bacilliformis metabolic network reconstructions due to its essential role in energy metabolism . Druggability assessments highlight its conserved regions as targets for small-molecule inhibitors .

4.2. Diagnostic Tool Development

Recombinant ATP synthase subunits (e.g., B. tribocorum atpB) are used in serological assays . While B. bacilliformis-specific atpB is underexplored, homologs like Pap31 and BafA demonstrate the utility of recombinant proteins in diagnostics .

Research Gaps and Future Directions

  • Structural data: Cryo-EM or crystallography studies are needed to resolve B. bacilliformis atpB architecture.

  • Functional assays: Proton translocation efficiency and inhibitor sensitivity remain uncharacterized.

  • Species-specific variations: Differences in atpB sequences across Bartonella spp. may influence pathogenicity and drug response .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpB; BARBAKC583_0376; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Bartonella bacilliformis (strain ATCC 35685 / KC583)
Target Names
atpB
Target Protein Sequence
MTSHAPDPIHQFEISRLINVSIGNVDFSFTNVSFFIIATVVLSSVFLFISSSSRRLVPTR MQSISEMAYEFVASTLRESAGVQGMKFFPLVFSLFVFILVANFIGLFPYFYTITSQIMIT FSLAMLVILTVIGCGFYKHGIGFLKLFVPSGVPVMILPLVTVIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMVGLGFIGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH
Uniprot No.

Target Background

Function

Key Function: A crucial component of the proton channel, directly involved in proton translocation across membranes.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) in Bartonella bacilliformis?

ATP synthase subunit a (atpB) in B. bacilliformis is a critical membrane-embedded component of the F₀ sector of the ATP synthase complex. This protein consists of approximately 250 amino acids and forms part of the proton channel essential for ATP synthesis. The subunit contains multiple transmembrane helices that create the pathway for proton translocation across the bacterial membrane, which drives the rotary mechanism of ATP synthesis . As part of the membrane-embedded F₀ region, atpB plays a crucial role in converting the energy of the proton gradient into mechanical rotation, ultimately leading to ATP production.

How does ATP synthase function in Bartonella species?

ATP synthases in Bartonella species, similar to other bacteria, produce ATP from ADP and inorganic phosphate using energy from a transmembrane proton motive force. The enzyme functions through a rotary mechanism where:

  • Protons flow through the membrane-embedded F₀ sector (containing subunit a)

  • This proton flow drives rotation of the c-ring

  • The rotation is transmitted via the central stalk to the F₁ sector

  • Conformational changes in the catalytic F₁ sector lead to ATP synthesis

The bacterial ATP synthase can also function in reverse, hydrolyzing ATP to pump protons across the membrane. This reverse function is regulated by subunit ε, which can adopt different conformations depending on ATP concentration . The ATP synthase complex in Bartonella species is structurally simpler than its mitochondrial counterpart but performs the same core functions, with loops in subunit a filling the role of additional subunits present in the mitochondrial enzyme .

What is the genetic organization of ATP synthase genes in B. bacilliformis?

While specific information about B. bacilliformis is limited, ATP synthase genes in bacteria are typically organized in an operon called the atp operon. Based on other bacterial species and information about related Bartonella species, the gene order is likely:

GeneEncodesFunction
atpBSubunit aForms proton channel
atpESubunit cForms c-ring rotor
atpFSubunit bForms peripheral stalk
atpHSubunit δPart of the stator
atpASubunit αCatalytic subunit
atpGSubunit γCentral rotor shaft
atpDSubunit βCatalytic subunit
atpCSubunit εRegulatory subunit

The presence of atpG (encoding subunit b/b') in B. bacilliformis has been confirmed , suggesting the conservation of this operon structure.

What expression systems are optimal for producing recombinant B. bacilliformis atpB?

Based on successful expressions of related proteins, E. coli represents the most viable expression system for B. bacilliformis atpB. An optimized protocol would include:

  • Expression vector: A pET-based vector with T7 promoter control provides high-level inducible expression. The pET24a vector has been successfully used for expressing other Bartonella proteins .

  • Fusion tags: An N-terminal His-tag facilitates purification by immobilized metal affinity chromatography. Similar approaches have been successful for B. tribocorum ATP synthase subunit a .

  • E. coli strain: BL21(DE3) or derivatives like C41(DE3)/C43(DE3) that are optimized for membrane protein expression.

  • Expression conditions:

    • Growth at 37°C to mid-log phase

    • Induction with 0.1-0.5 mM IPTG

    • Post-induction expression at lower temperature (16-20°C) for 6-18 hours

    • Supplementation with glucose to suppress basal expression

  • Membrane protein considerations:

    • Addition of detergents (n-dodecyl-β-D-maltoside or lauryl maltose neopentyl glycol) during cell lysis

    • Careful optimization of solubilization conditions

This approach has yielded functional recombinant ATP synthase subunits from related bacteria and should be applicable to B. bacilliformis atpB .

What purification methods yield the highest purity recombinant B. bacilliformis atpB?

A comprehensive purification strategy for B. bacilliformis atpB would involve:

  • Membrane preparation:

    • Cell disruption by French press or sonication in buffer containing protease inhibitors

    • Differential centrifugation to isolate membrane fraction

    • Solubilization with appropriate detergents (0.5-2% DDM, LMNG, or digitonin)

  • Affinity chromatography:

    • Ni-NTA or Co-NTA resin for His-tagged protein

    • Optimization of imidazole gradient (20-250 mM) to minimize non-specific binding

    • Buffer containing 0.05-0.1% detergent to maintain protein solubility

  • Secondary purification:

    • Size exclusion chromatography using Superdex 200 column

    • Ion exchange chromatography as needed

  • Quality control:

    • SDS-PAGE with Coomassie staining (>90% purity)

    • Western blotting with anti-His antibodies

    • Mass spectrometry to confirm identity

    • Circular dichroism to verify secondary structure

For long-term storage, the purified protein can be maintained in buffer containing glycerol (25-50%) at -80°C or lyophilized as described for B. tribocorum ATP synthase subunit a .

How can activity assays be optimized for recombinant B. bacilliformis ATP synthase?

Functional characterization of recombinant B. bacilliformis ATP synthase requires carefully optimized activity assays:

ATP synthesis assay:

  • Reconstitute purified ATP synthase in liposomes (E. coli polar lipids with 20% phosphatidylcholine)

  • Establish a proton gradient by acid-base transition or potassium/valinomycin system

  • Add ADP (1-2 mM) and Pi (5-10 mM) in the presence of Mg²⁺ (5 mM)

  • Measure ATP production using:

    • Luciferase-based luminescence assay

    • Coupled enzyme assay (hexokinase/glucose-6-phosphate dehydrogenase)

ATP hydrolysis assay:

  • Monitor Pi release using:

    • Malachite green assay (sensitive to nanomolar range)

    • EnzChek Phosphate Assay Kit (continuous monitoring)

  • Use coupled enzyme system:

    • Pyruvate kinase and lactate dehydrogenase

    • Monitor NADH oxidation at 340 nm

Optimization parameters:

  • pH range (6.0-8.5)

  • Temperature (25-42°C)

  • Ionic strength (50-200 mM KCl)

  • Divalent cation concentration (1-10 mM Mg²⁺)

  • Detergent type and concentration for soluble assays

Controls:

  • Include specific inhibitors (oligomycin, DCCD) to verify ATP synthase activity

  • Use denatured enzyme or preparations lacking key subunits as negative controls

These assays would provide quantitative assessment of B. bacilliformis ATP synthase function and allow comparison with ATP synthases from other bacterial species.

How does structural analysis of B. bacilliformis atpB contribute to understanding proton translocation?

Structural analysis of B. bacilliformis atpB would reveal crucial details about the proton translocation mechanism:

  • Transmembrane helices arrangement: The orientation and packing of transmembrane helices would reveal the architecture of the proton half-channels, similar to what has been observed in other bacterial ATP synthases .

  • Key residues identification: Structural data would pinpoint the position of the conserved arginine residue that is essential for proton translocation and reveal other functionally important residues.

  • AtpB-c-ring interface: The structure would show how subunit a interfaces with the c-ring, revealing the path of protons from the periplasmic half-channel to the c-ring and then to the cytoplasmic half-channel.

  • Conformational states: Multiple structures in different states would show any conformational changes that occur during proton translocation, as seen in the Bacillus PS3 ATP synthase structures that captured three different rotational states .

  • Species-specific adaptations: Structural features unique to B. bacilliformis might reveal adaptations to its particular ecological niche or pathogenic lifestyle.

Such structural information would provide the framework for understanding the molecular mechanism of proton translocation and potentially reveal targets for antimicrobial development against this pathogen.

What role might B. bacilliformis ATP synthase play in pathogenicity?

While direct evidence linking ATP synthase to B. bacilliformis pathogenicity is limited, several potential connections can be inferred:

  • Energy provision for virulence: ATP synthase provides the energy required for various virulence processes, including:

    • Invasion of host erythrocytes via the IalB protein

    • Production of virulence factors like the BafA autotransporter

    • Survival within the host under nutrient-limited conditions

  • Adaptation to different infection phases: B. bacilliformis causes a biphasic illness (Carrion's disease) , and ATP synthase may help the bacterium adapt to different energy requirements during:

    • The acute phase (Oroya fever) characterized by severe hemolytic anemia

    • The chronic phase (verruga peruana) characterized by vascular proliferative lesions

  • Environmental sensing: ATP synthase activity is influenced by pH and ion gradients. The BatR/BatS two-component system in Bartonella acts as a pH sensor , potentially coordinating ATP synthesis with environmental conditions during infection.

  • Potential drug target: As an essential enzyme, ATP synthase represents a potential target for new antimicrobials against B. bacilliformis, aligning with efforts to identify drug targets in this pathogen .

  • Support for angiogenic processes: B. bacilliformis induces pathological angiogenesis , a process requiring significant energy that would depend on ATP synthase function.

Understanding the specific contributions of ATP synthase to B. bacilliformis pathogenicity could reveal new approaches for treating Carrion's disease.

How do genomic variations in atpB impact ATP synthase function across Bartonella species?

Analysis of genetic variation in atpB across Bartonella species provides insights into functional adaptation:

  • Phylogenetic analysis: Comparison of atpB sequences could reveal evolutionary relationships among Bartonella species. Similar phylogenetic approaches using other genes (gltA, ialB, rpoB) have provided insights into B. bacilliformis diversity .

  • Functional domains conservation: Identification of highly conserved regions across Bartonella species would highlight domains critical for ATP synthase function, while variable regions might reflect adaptation to specific hosts or niches.

  • Non-synonymous mutations: Analysis of non-synonymous mutations in atpB, similar to those identified in other B. bacilliformis genes , could reveal adaptive changes affecting:

    • Proton channel structure

    • Interaction with other ATP synthase subunits

    • Regulatory mechanisms

  • Regional variations: Genomic studies have revealed distinct subgroups of B. bacilliformis in different geographic regions . Similar analysis of atpB might show regional adaptations of ATP synthase.

  • Comparative expression analysis: Expression levels of atpB under different conditions (pH, temperature, oxygen levels) across Bartonella species could reveal regulatory differences reflecting their pathogenic strategies.

This genomic analysis would contribute to understanding how ATP synthase has evolved in different Bartonella species and potentially explain differences in their pathogenicity and host range.

What structural analysis techniques provide the most insight into B. bacilliformis atpB conformation?

Multiple complementary techniques would provide comprehensive structural characterization of B. bacilliformis atpB:

Integration of data from these complementary techniques would provide a comprehensive structural understanding of B. bacilliformis atpB and its role in ATP synthase function.

How can site-directed mutagenesis of recombinant B. bacilliformis atpB help understand proton channeling?

Site-directed mutagenesis represents a powerful approach to dissect the proton channeling mechanism in B. bacilliformis ATP synthase:

Key residues to target:

  • The conserved arginine residue in the middle of the membrane, essential for proton transfer

  • Polar residues lining the proton half-channels

  • Residues at the interface with the c-ring

  • Amino acids involved in salt bridges or hydrogen-bonding networks

Experimental design:

  • Generate single-point mutations using PCR-based methods

  • Express and purify mutant proteins using the same protocols as wild-type

  • Reconstitute into liposomes for functional assays

  • Assess structural integrity using CD spectroscopy or limited proteolysis

Functional analysis:

  • Measure ATP synthesis rates compared to wild-type

  • Determine proton translocation efficiency using pH-sensitive dyes

  • Analyze the effect on c-ring rotation using appropriate biophysical methods

  • Determine the impact on ATP hydrolysis activity

Structural analysis:

  • Obtain structures of key mutants to observe conformational changes

  • Use molecular dynamics simulations to predict effects on proton movement

  • Calculate energetics of proton transfer through wild-type and mutant channels

This systematic mutagenesis approach would provide detailed insights into how specific residues contribute to proton channeling and the coupling between proton flow and ATP synthesis in B. bacilliformis ATP synthase.

What is the potential of recombinant B. bacilliformis atpB as a diagnostic target?

While ATP synthase subunits have not been extensively explored as diagnostic targets for Bartonella infections, several factors suggest potential utility:

  • Conservation and specificity: ATP synthase is essential in all Bartonella species but contains species-specific regions that could serve as diagnostic epitopes for B. bacilliformis-specific detection.

  • Immunogenicity assessment: Before developing diagnostic assays, the immunogenicity of B. bacilliformis atpB would need to be evaluated through:

    • Screening patient sera from confirmed cases

    • Comparison with known immunogenic proteins like Pap31

    • Epitope mapping to identify highly antigenic regions

  • Potential diagnostic formats:

    • ELISA using recombinant atpB as capture antigen

    • Western blot analysis for confirmatory testing

    • Lateral flow assays for point-of-care diagnostics

  • Performance benchmarking: Any new diagnostic would need comparison with existing methods:

    • Indirect immunofluorescence assay (IFA), the current standard

    • PCR-based detection methods

    • Other recombinant antigen-based tests like those using Pap31

  • Considerations for optimization:

    • Selection of protein fragments with highest specificity

    • Evaluation of cross-reactivity with other Bartonella species

    • Determination of sensitivity and specificity in clinical samples

The potential of atpB as a diagnostic target would need to be evaluated against established antigens like Pap31, which has shown promising results in ELISA formats for Bartonella detection .

How does B. bacilliformis ATP synthase compare to ATP synthases from other pathogens?

Comparative analysis of B. bacilliformis ATP synthase with those from other pathogens reveals important differences and similarities:

  • Structural comparisons:

    • Bacterial ATP synthases share the same core architecture but differ in specific subunit structures

    • B. bacilliformis ATP synthase likely resembles that of Bacillus PS3, with the catalytic β subunits adopting 'open', 'closed', and 'open' conformations

    • This differs from E. coli ATP synthase, which shows 'half-closed', 'closed', and 'open' conformations

  • Regulatory mechanisms:

    • Bacterial ATP synthases show species-specific regulatory mechanisms

    • In Bacillus PS3, ATP synthase inhibition by subunit ε is ATP concentration-dependent

    • In E. coli, inhibition persists even at high ATP concentration when proton motive force is insufficient

    • B. bacilliformis regulation may reflect its adaptation to changing host environments

  • Sequence conservation table (hypothetical example based on available data):

ATP Synthase RegionSequence Identity with B. bacilliformis
E. coli65-70%
Bacillus species70-75%
Other Bartonella85-95%
Mitochondrial45-50%
  • Functional adaptations:

    • ATP synthases from different pathogens may be optimized for their specific infection niches

    • B. bacilliformis ATP synthase may have adaptations for functioning in both sandfly vectors and human hosts

    • Differences in proton channel residues might reflect adaptation to different pH environments

  • Drug target potential:

    • Unique features of B. bacilliformis ATP synthase could be exploited for selective inhibition

    • Comparative analysis helps identify conserved regions as broad-spectrum targets

    • Species-specific regions could enable selective targeting

This comparative analysis provides context for understanding the unique features of B. bacilliformis ATP synthase and its potential as a drug target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.