Recombinant Bartonella bacilliformis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; BARBAKC583_0292; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Bartonella bacilliformis (strain ATCC 35685 / KC583)
Target Names
mscL
Target Protein Sequence
MLKEFKQFALKGNMVDLAVGVIIGSAFGGLVNSVVNDIFMPIIGLITGGIDFSNMFIQLA GDKKATLLAAKEAGATLSYGNFITLLINFLIISWILFFLVKGMNKMTQKQEEVEKPKEMS PEGKLLTEIRDLLAAQKE
Uniprot No.

Target Background

Function

Recombinant Bartonella bacilliformis Large-conductance mechanosensitive channel (mscL): A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure changes.

Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant Bartonella bacilliformis MscL typically expressed and purified?

Recombinant expression typically involves the following methodological approach:

  • Expression system: The full-length protein (1-138aa) is fused to an N-terminal His tag and expressed in E. coli expression systems .

  • Purification protocol:

    • Affinity chromatography using the His-tag

    • Purification to >90% purity as determined by SDS-PAGE

    • Final product is typically prepared as a lyophilized powder

  • Buffer conditions: The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

Researchers should note that while alternative expression systems could be explored, E. coli remains the most established system for recombinant MscL production due to its simplicity and cost-effectiveness.

What are the optimal storage and reconstitution conditions for recombinant MscL proteins?

Based on experimental best practices, the following conditions are recommended:

ParameterRecommendationNotes
Long-term storage-20°C to -80°CAliquoting is necessary to avoid freeze-thaw cycles
Working aliquots4°CStable for up to one week
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation prior to opening is recommended
Glycerol addition5-50% (final concentration)50% is the standard recommendation

Researchers should avoid repeated freeze-thaw cycles as they can significantly degrade protein quality and function . When preparing for functional studies, it's advisable to verify protein integrity via SDS-PAGE before proceeding with experimental protocols.

How does MscL protect bacterial cells during osmotic shock?

MscL serves as a critical component of bacterial osmotic defense mechanisms through several coordinated processes:

  • Mechanosensing: During hypoosmotic shock, increased membrane tension activates the MscL channel

  • Channel gating: The channel protein opens in response to stretch forces in the lipid bilayer, creating a large non-selective pore

  • Pressure relief: The open channel allows rapid efflux of cytoplasmic solutes, preventing excessive cell swelling

  • Upregulation: During stationary phase and osmotic challenge, MscL expression is upregulated to enhance cellular protection

This protective mechanism is particularly important for preventing cell lysis during environmental transitions, which is crucial for bacteria like Bartonella bacilliformis that alternate between vector and human host environments with different osmotic conditions.

What experimental approaches are most effective for studying MscL gating mechanisms?

Several complementary approaches have proven valuable for investigating MscL gating mechanisms:

  • Integrated experimental-computational methods:

    • Combining coarse-grained (CG) simulations with restraints from EPR and FRET experiments has been effective for modeling MscL gating without applying excessive tension

    • This approach provides greater conformational sampling than is possible with standard atomistic simulations

  • Patch clamp electrophysiology:

    • Allows direct measurement of channel activity in response to membrane tension

    • Can determine the tension required to induce gating (approximately 12 dynes/cm under physiological conditions)

  • Single-cell analysis platforms:

    • Quantitative measurement of MscL copy number versus survival at single-cell resolution

    • Automated image processing and segmentation for high-throughput analysis

  • Structural analysis techniques:

    • CG MD simulations in the microsecond range (versus nanosecond range for atomistic simulations)

    • Analysis of inter-subunit distances and solvent accessibility data from EPR and FRET experiments

These approaches collectively provide a multi-scale understanding of MscL function, from molecular dynamics to cellular outcomes.

How do lipid compositions affect the function of Bartonella bacilliformis MscL?

The lipid environment significantly modulates MscL function through several mechanisms:

  • Membrane tension transduction:

    • Research shows that the tension required to induce MscL gating in patch clamp experiments (~12 dynes/cm) differs from that needed in simulations (often ~30 dynes/cm)

    • This discrepancy highlights the critical role of the native lipid environment in channel sensitivity

  • Hydrophobic mismatch effects:

    • Changes in membrane curvature and/or transbilayer pressure profile affect gating via the bilayer mechanism

    • The hydrophobic mismatch between the protein and surrounding lipids influences channel function

  • Methodological considerations:

    • When studying MscL function in vitro, researchers should consider using lipid compositions that mimic bacterial membranes

    • CG simulations with varying lipid compositions can help predict how membrane environment affects channel gating

Understanding these lipid-protein interactions is critical for accurate interpretation of experimental data and development of potential antimicrobial strategies targeting MscL function.

What are the challenges in applying MALDI-TOF MS for identification of MscL proteins from Bartonella species?

MALDI-TOF MS analysis of proteins from Bartonella species presents several methodological challenges:

  • Growth time variability:

    • The mass spectra from Bartonella strains with different growth times (e.g., 14 vs. 28 days) do not match each other, leading to potential misidentification

    • This is particularly problematic as Bartonella species are fastidious bacteria with growth times varying from one to six weeks

  • Database limitations:

    • Commercial databases often lack reference spectra for uncommon or neglected bacteria like Bartonella spp.

    • This limits identification capabilities in non-specialized laboratories

  • Recommended solutions:

    • Create database entries with multiple spectra from strains with different growth times

    • Include reference spectra for specific proteins like MscL to improve identification accuracy

These challenges highlight the importance of standardized protocols for Bartonella protein analysis, particularly for structural and functional studies of MscL channels.

How can computational modeling be used to predict the behavior of MscL channels under various conditions?

Computational modeling offers powerful approaches for investigating MscL function:

  • Coarse-grained molecular dynamics (CG MD) simulations:

    • Enable simulations in the microsecond range, capturing structural changes not visible in shorter atomistic simulations

    • Allow exploration of multiple parameter combinations (e.g., membrane tension, lipid composition)

  • Integration with experimental restraints:

    • Incorporating inter-subunit distances and solvent accessibility data from EPR and FRET experiments

    • This hybrid approach provides more realistic models than either method alone

  • Parameter exploration:

    • Testing different membrane tensions (12-30 dynes/cm)

    • Modeling various combinations of solvent and distance restraints

    • Examining how gradual introduction of restraints affects protein conformational changes

  • Validation approach:

    • Multiple simulations with different combinations of restraints and tension

    • Comparison of final structure to experimental data

    • Assessment of water permeation and pore stability

These computational approaches can predict channel behavior under conditions difficult to achieve experimentally, generating testable hypotheses for further investigation.

What methods are available for measuring MscL channel activity in native versus recombinant systems?

Several complementary approaches can be employed to study MscL function across different experimental systems:

  • Single-cell resolution methods:

    • Segmentation of individual cells in phase contrast imaging

    • Measurement of MscL expression via mean pixel value of fluorescence images

    • Manual classification of survival/death following osmotic down-shock

  • Image processing protocols:

    • Filtering operations to reduce high-frequency noise and correct for uneven illumination

    • Automated linkage between segmented cells and manual markers

    • Statistical analysis of segmented objects combined with experimental metadata

  • Functional assays for recombinant systems:

    • Patch clamp electrophysiology to measure single-channel conductance

    • Osmotic downshock survival assays to assess channel functionality

    • Fluorescence-based assays for monitoring channel activity in reconstituted vesicles

  • Comparative analysis framework:

    • Determination of structure-function relationships between native and recombinant MscL

    • Assessment of how expression system affects protein folding and activity

    • Evaluation of how His-tag or other modifications influence channel behavior

This multi-method approach enables researchers to comprehensively characterize MscL channels and validate findings across different experimental systems.

How does Bartonella bacilliformis MscL compare to MscL proteins from other bacterial species?

Comparative analysis reveals several important distinctions between MscL proteins across bacterial species:

  • Sequence variations:

    • Bartonella bacilliformis MscL consists of 138 amino acids

    • Psychrobacter sp. MscL contains 143 amino acids

    • These variations may impact channel gating properties and sensitivity to membrane tension

  • Functional conservation:

    • Despite sequence differences, the core function of providing protection against osmotic shock appears conserved

    • All MscL proteins form homopentameric channels that gate in response to membrane tension

  • Potential therapeutic relevance:

    • MscL channels have been identified as potential targets for new antibiotics against multiple drug-resistant bacterial strains

    • Species-specific differences in MscL structure could be exploited for selective targeting

  • Methodological considerations for researchers:

    • When using MscL as a model system, researchers should account for species-specific variations

    • Extrapolation of findings from one bacterial species to another requires careful validation

Understanding these comparative aspects is essential for researchers working with MscL channels from different bacterial sources.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.