Recombinant Bartonella bacilliformis NADH-quinone oxidoreductase subunit K (nuoK)

Basic Research Questions

• What is Bartonella bacilliformis and what disease does it cause?

  Bartonella bacilliformis is a human-restricted, vectorborne pathogenic bacterium that causes Carrion's disease, a neglected tropical disease endemic to the Andean region of South America. The disease manifests in two distinct phases: an acute phase known as Oroya fever and a chronic phase characterized by skin eruptions called verruga peruana. Without antimicrobial treatment, Carrion's disease has a mortality rate of up to 88% in infected patients . B. bacilliformis is transmitted by phlebotomine sand flies, particularly Lutzomyia verrucarum, in high-altitude valleys of the Andes .

• What is NADH-quinone oxidoreductase subunit K (nuoK) in Bartonella bacilliformis?

  NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the NADH dehydrogenase I complex (NDH-1) in Bartonella bacilliformis. The protein is encoded by the nuoK gene (BARBAKC583_0788) . It is a relatively small protein consisting of 102 amino acids with the sequence: MYIGIAHYLTVSAIMFTVGIFGIFLNRKNVIIILMSIELILLSVNLNFVAFSAFLHDLVGQIFALFILTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG . This protein functions as part of the electron transport chain involved in cellular respiration and energy production in the bacterium.

• How is Bartonella bacilliformis transmitted and what is its geographic distribution?

  B. bacilliformis is transmitted by phlebotomine sand flies (particularly Lutzomyia verrucarum) . The pathogen's distribution is restricted primarily to the high-altitude valleys of the South American Andes, particularly in Peru, Ecuador, and Colombia . Recent research has detected B. bacilliformis DNA in wild-captured Pintomyia robusta sand flies in the border region between Ecuador and Peru . Unlike other Bartonella species that have worldwide distribution, B. bacilliformis is geographically limited to certain parts of South America .

Intermediate Research Questions

• What expression systems are used for producing recombinant Bartonella bacilliformis proteins?

  Several expression systems have been documented for producing recombinant B. bacilliformis proteins:

  • E. coli expression system: Used for expressing proteins like Pap31, where the gene is amplified by PCR from B. bacilliformis isolates and cloned into vectors like pET24a .

  • Baculovirus-insect cell expression system: Particularly using the flashBAC ULTRA technology. Research showed that optimal expression conditions for B. bacilliformis recombinant proteins involved using High Five™ cells at 21°C with harvesting at 120 hours post-infection .

  • Yeast, mammalian cell systems: Also mentioned as potential expression hosts for recombinant B. bacilliformis proteins .

  The choice of expression system depends on the specific research goals, the nature of the protein, and requirements for post-translational modifications.

• How can researchers optimize the production of recombinant nuoK protein?

  Optimization of recombinant nuoK production involves several methodological considerations:

  • Expression system selection: Using systems like E. coli for basic structural studies or baculovirus-insect cells when post-translational modifications are important .

  • Temperature control: Lower temperatures (21°C) can improve protein folding and yield for B. bacilliformis proteins .

  • Harvest timing: For baculovirus systems, optimal harvesting at 120 hours post-infection has been demonstrated for B. bacilliformis proteins .

  • Buffer optimization: Storage in Tris-based buffers with 50% glycerol has been shown to maintain protein stability .

  • Storage conditions: Maintaining stocks at -20°C/-80°C with aliquoting to avoid repeated freeze-thaw cycles that may compromise protein integrity .

• What purification methods are effective for recombinant Bartonella bacilliformis proteins?

  Effective purification strategies for recombinant B. bacilliformis proteins include:

  • Affinity chromatography: Using tags like His-tags for selective binding to metal-chelating resins, allowing for efficient single-step purification .

  • Size exclusion chromatography: For further purification based on molecular size, particularly useful for removing aggregates or truncated products.

  • Ion exchange chromatography: Useful as a polishing step to remove contaminants with different charge properties.

  Researchers typically aim for >90% purity as determined by SDS-PAGE analysis . For membrane proteins like nuoK, addition of appropriate detergents during purification is critical for maintaining solubility and native conformation.

Advanced Research Questions

• How can recombinant nuoK be used in diagnostic applications for Bartonella infections?

  Recombinant nuoK shows potential for diagnostic applications through several methodological approaches:

  • ELISA development: Similar to other B. bacilliformis recombinant proteins like Pap31, nuoK could be used to develop ELISA tests for serological diagnosis. Research with Pap31 demonstrated that recombinant protein-based ELISA could clearly differentiate between positive and negative sera with no overlap in readings .

  • Western blot applications: Recombinant nuoK can be used in Western blot assays to identify specific antibody responses in patient sera, providing confirmatory diagnosis.

  • Point-of-care rapid tests: For rural clinical settings in endemic areas, recombinant nuoK could be incorporated into lateral flow immunoassays for field diagnosis without sophisticated laboratory equipment .

  • Multiplex assays: Combining nuoK with other B. bacilliformis antigens could improve diagnostic sensitivity and specificity, addressing the limitations of current serological assays .

• What is known about the evolutionary adaptation of Bartonella bacilliformis and its proteins?

  Research on B. bacilliformis evolution reveals several key insights:

  • Genome reduction: Despite being the most virulent Bartonella species, B. bacilliformis has one of the most reduced genomes in the genus, suggesting specialized adaptation to its human host and sand fly vector .

  • Mutation-driven evolution: Comparative genomic analyses demonstrate that B. bacilliformis evolution is shaped predominantly by mutation rather than recombination .

  • Sub-speciation: High mutational divergence of core genes has led to multiple sub-species, with evidence suggesting a recent sub-speciation event possibly accelerated by the emergence of a mutator phenotype .

  • Convergent evolution: Within sub-species, there is evidence of inter-clonal adaptive evolution through non-neutral accumulation of convergent amino acid mutations, indicating evolution along common adaptive routes .

  • Functional conservation: Key functional categories like DNA repair, glucose metabolic processes, ATP-binding, and ligase activity are over-represented among genes showing adaptive mutational convergence .

• How does nuoK contribute to the pathogenicity and metabolism of Bartonella bacilliformis?

  As a component of NADH dehydrogenase I (Complex I), nuoK plays several critical roles in B. bacilliformis physiology and potentially its pathogenicity:

  • Energy metabolism: nuoK contributes to the electron transport chain function, facilitating energy production through oxidative phosphorylation, which is essential for bacterial survival in the host environment.

  • Membrane potential maintenance: As part of the proton-pumping machinery, nuoK helps maintain bacterial membrane potential, which is crucial for various cellular processes including nutrient uptake and toxin export.

  • Adaptation to microenvironments: The electron transport chain allows adaptation to varying oxygen conditions encountered during infection, potentially contributing to bacterial persistence.

  • Potential drug target: As a critical metabolic component, nuoK represents a potential antimicrobial target, especially relevant given the high mortality rate of untreated Carrion's disease (up to 88%) .

  Research methodologies to investigate these roles include gene knockout studies, site-directed mutagenesis, and comparative analysis of nuoK expression under different environmental conditions mimicking those encountered during infection.

• What techniques are most effective for studying the structural and functional aspects of membrane proteins like nuoK?

  Several specialized techniques are particularly valuable for studying membrane proteins like nuoK:

  • Cryo-electron microscopy: Allows visualization of membrane protein structure in near-native environments without crystallization.

  • Lipid nanodiscs: Enable study of membrane proteins in a lipid bilayer environment that mimics their natural setting.

  • Site-directed spin labeling combined with EPR spectroscopy: Provides information about protein dynamics and conformational changes in the membrane environment.

  • Molecular dynamics simulations: Help predict protein behavior in membranes and interactions with other components.

  • Proteoliposome reconstitution: Allows functional assays of purified membrane proteins in artificial lipid vesicles to study transport properties.

  • Isothermal titration calorimetry: For measuring binding affinities and thermodynamic parameters of interactions with small molecules or other proteins.

  These approaches collectively provide a comprehensive understanding of structure-function relationships in membrane proteins like nuoK that are challenging to study with traditional biochemical methods.

• How can researchers overcome challenges in the serological diagnosis of Bartonella infections?

  Current serological assays for B. bacilliformis infections have limitations in sensitivity and specificity . Researchers can address these challenges through:

  • Recombinant antigen selection: Identifying immunodominant antigens (like nuoK) through immunoproteomic approaches, including 2D gel electrophoresis followed by Western blot analysis with patient sera .

  • Multiple antigen panels: Developing diagnostic tests that use multiple recombinant proteins simultaneously to improve sensitivity while maintaining specificity.

  • Cross-reactivity assessment: Thoroughly evaluating potential cross-reactivity with other pathogens endemic to the same regions.

  • Optimization of cut-off values: Establishing appropriate positive/negative thresholds based on testing with well-characterized patient cohorts.

  • Combined testing approaches: Integrating PCR-based detection of bacterial DNA with serological assays for definitive diagnosis.

  • Field validation: Testing diagnostic performance in endemic settings with diverse patient populations and disease presentations .

Research Applications and Future Directions

• What role might nuoK play in developing new therapeutic approaches for Bartonella infections?

  As a component of the essential respiratory chain, nuoK represents a potential therapeutic target. Research approaches might include:

  • Small molecule inhibitor screening: Developing high-throughput assays to identify molecules that specifically inhibit nuoK function.

  • Structural analysis for rational drug design: Using structural data to design inhibitors that specifically target unique features of B. bacilliformis nuoK.

  • Peptide-based inhibitors: Designing peptides that interfere with nuoK assembly into the NADH dehydrogenase complex.

  • Combination therapy approaches: Investigating synergistic effects of targeting nuoK along with other cellular processes.

  • Delivery systems for membrane-targeted compounds: Developing approaches to effectively deliver hydrophobic inhibitors to the bacterial membrane where nuoK resides.

• How can recombinant B. bacilliformis proteins contribute to vaccine development?

  Recombinant proteins from B. bacilliformis, including potentially nuoK, offer several advantages for vaccine development:

  • Subunit vaccine approach: Using specific recombinant antigens rather than whole organisms provides better safety profiles and more consistent production.

  • Immunodominant antigen identification: Testing recombinant proteins like nuoK for their ability to elicit protective immune responses.

  • Adjuvant combination studies: Determining optimal adjuvant formulations that enhance immune responses to B. bacilliformis recombinant proteins.

  • Multivalent vaccine development: Combining multiple recombinant antigens to target different aspects of the pathogen's biology and life cycle.

  • Delivery platform evaluation: Testing different vaccine delivery systems (e.g., nanoparticles, virus-like particles) for optimal presentation of recombinant antigens.

  This approach is particularly important for Carrion's disease, which has been identified by the World Health Organization as a disease amenable to elimination .

• What are the most promising molecular techniques for studying Bartonella species in vector populations?

  Recent advances in molecular techniques have improved our ability to study Bartonella in vector populations:

  • Quantitative real-time PCR: Targeting specific genes like the 16S-23S internal transcribed spacer intergenic region has been successful in detecting Bartonella DNA in sand fly specimens (with detection rates of 8.7% reported in Brazilian sand flies) .

  • Multilocus sequence typing (MLST): Provides high-resolution genotyping for differentiating Bartonella species and strains in vectors.

  • Next-generation sequencing: Allows for metagenomic analysis of vector microbiomes, identifying Bartonella species even in vectors with low bacterial loads.

  • Droplet digital PCR (ddPCR): Offers improved sensitivity for detecting Bartonella DNA in vectors compared to conventional PCR.

  • Phylogenetic analysis: Using genes like gltA to position Bartonella sequences from vectors in evolutionary context, as demonstrated by research that placed a Lutzomyia longipalpis sand fly-associated Bartonella sequence in the same subclade as B. ancashensis .