Recombinant Bartonella bacilliformis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Functional Role of Lgt

Lgt catalyzes the transfer of an sn-1,2-diacylglyceryl group from phosphatidylglycerol to the cysteine residue of prolipoproteins, forming a thioether bond . This modification anchors lipoproteins to bacterial membranes and is essential for:

  • Membrane integrity: Proper localization of lipoproteins in the inner or outer membrane .

  • Virulence: Lipoproteins in Bartonella species mediate host-cell interactions and immune evasion .

  • Viability: Lgt depletion in Escherichia coli and other bacteria is lethal, highlighting its indispensability .

Recombinant Production in Bartonella bacilliformis

While recombinant Lgt from B. bacilliformis has not been explicitly reported, methodologies for other B. bacilliformis antigens (e.g., Pap31, LptD) provide a framework:

Cloning and Expression

  • Vector systems: pET24a (for Pap31) , pBac-1 (baculovirus system for Prot_689/Prot_504) .

  • Induction: Optimized conditions (e.g., 0.5 mM IPTG, 28°C, 16-hour induction) .

  • Hosts: E. coli BL21(DE3) pLysS or insect cells (High Five™) .

Table 2: Recombinant Protein Yields in B. bacilliformis

ProteinExpression SystemYield (μg/mL)Antigenicity Confirmed
Pap31E. coli31 kDa bandYes (Western Blot)
LptD (dexr)E. coli2.6Yes (patient sera)
Prot_689Baculovirus120 hpiPending

Antigenic and Diagnostic Potential

Recombinant B. bacilliformis lipoproteins (e.g., Pap31, LptD) are immunogenic and used in serodiagnostics . Key findings:

  • Pap31: Dominant antigen in 2D gel analysis; ELISA sensitivity confirmed with patient sera .

  • LptD: Linear epitopes recognized by Carrion’s disease sera despite denaturation .

Challenges and Future Directions

  • Low yields: Denaturing conditions for LptD purification reduced functional protein recovery .

  • Structural studies: Requires refolding or native purification to assess conformational epitopes .

  • Vaccine development: Multiepitope constructs (e.g., combining LptD with other antigens) proposed .

Comparative Genomics and Phylogeny

  • Host niche: Intracellular survival in erythrocytes .

  • Immune evasion: Lipoprotein modifications reduce TLR4 recognition (e.g., B. quintana) .

Implications for Drug Development

Lgt is a potential antibacterial target due to its essential role. Inhibitors targeting conserved residues (e.g., Y26, N146) could disrupt lipoprotein maturation .

Key Gaps in Research

  1. Direct characterization of B. bacilliformis Lgt remains unreported.

  2. Functional assays (e.g., enzymatic activity of recombinant Lgt) are needed.

  3. Role of Lgt in Bartonella virulence (e.g., endothelial proliferation ) is unexplored.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, kindly note it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributor for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; BARBAKC583_0994; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Bartonella bacilliformis (strain ATCC 35685 / KC583)
Target Names
lgt
Target Protein Sequence
MNNFLSCPAIPFPNFLDPIIIQLGPIALHWYGLGYVVGILFSWWYVQKLSHKKSLWYANY PPLNAEKASDFVVWAALGIVVGGRLGQVLIWDPTYYFNHPSSIIAVWDGGMSFHGGLIGT TIAIIWFARKHNINIWAMFDTIAAGAPFGIGVVRICNFINQELWGSVTNVPWAVCFSLDP QYLPRHPSQLYEALMEGFLLFIVLAFIIFAFKAFKRPGTVAGTFIISYGIARTISEIFRV PQEDPEWFSALFHGSGFTYGMALSLPMILFGFYAIFRAFRNHFIK
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Prolipoprotein diacylglyceryl transferase (Lgt) in Bartonella species?

Prolipoprotein diacylglyceryl transferase (Lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification process of bacterial lipoproteins. The enzyme transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the invariant cysteine residue in the lipobox sequence of prolipoproteins . Crystal structures of Lgt (from E. coli) have revealed that the enzyme contains two binding sites and assumes a structure that facilitates lateral entry and exit of substrate and lipid-modified product relative to the lipid bilayer . The tertiary structure is critical for its catalytic function, with specific residues like Arg143 and Arg239 being essential for diacylglyceryl transfer .

For researchers investigating Bartonella bacilliformis Lgt specifically, it's important to note that while the core catalytic domain is likely conserved across bacterial species, there may be species-specific structural variations that affect substrate specificity or catalytic efficiency. Comparative structural analyses using homology modeling based on solved crystal structures can provide initial insights into B. bacilliformis Lgt structure before undertaking crystallization efforts.

How does the membrane association of Lgt affect its purification and study in recombinant systems?

Despite its classification as an integral membrane protein, research has revealed that Lgt exhibits a more complex membrane association pattern. Solubilization experiments have demonstrated that Lgt has a peripheral and possibly reversible hydrophobic association with the inner membrane on the cytosolic side, which contradicts its previously deduced transmembrane topology . This finding has significant implications for purification strategies.

When working with recombinant Bartonella bacilliformis Lgt, researchers should consider that the enzyme can be extracted with water or low ionic strength solutions from inverted vesicles, which simplifies purification procedures . The soluble enzyme maintains properties indistinguishable from the membrane-bound enzyme in terms of kinetic behavior, indicating that functional studies can be conducted in aqueous-compatible systems . This characteristic makes Lgt particularly amenable to recombinant expression and purification compared to many other membrane proteins.

For optimal results, researchers should:

  • Use mild detergents for initial extraction

  • Implement a purification strategy that preserves the native conformation

  • Verify functional activity of the purified enzyme using the paper electrophoretic assay method described in the literature

What are the critical sequence motifs and residues required for Lgt catalytic activity?

Based on structural and functional studies, several critical residues and motifs have been identified in Lgt that are essential for catalytic activity. Complementation experiments with Lgt-knockout cells using different mutant variants have revealed that Arg143 and Arg239 are indispensable for diacylglyceryl transfer activity . These positively charged residues likely interact with the negatively charged phosphate group of the phosphatidylglycerol substrate.

When examining the Bartonella bacilliformis Lgt sequence, researchers should focus on conserved motifs that are present across bacterial species. Multiple sequence alignment between B. bacilliformis Lgt and other characterized bacterial Lgt proteins can identify these conserved regions. Site-directed mutagenesis experiments targeting these conserved residues would be valuable for confirming their functional significance in the B. bacilliformis enzyme.

The table below summarizes key residues identified in Lgt enzymes that are likely to be conserved in B. bacilliformis:

Residue PositionAmino AcidProposed FunctionEffect of Mutation
143 (E. coli numbering)ArgininePhosphatidylglycerol bindingLoss of activity
239 (E. coli numbering)ArginineCatalytic siteLoss of activity
Lipobox binding domainMultiple residuesSubstrate recognitionReduced specificity

What are the optimal expression systems for producing recombinant Bartonella bacilliformis Lgt?

When selecting an expression system for recombinant B. bacilliformis Lgt, researchers must consider several factors that affect protein yield and functionality. E. coli-based expression systems are commonly used due to their simplicity and high yield, but careful optimization is required for membrane-associated proteins like Lgt.

For optimal expression of functional B. bacilliformis Lgt, consider the following approach:

  • Use E. coli BL21(DE3) or C41(DE3)/C43(DE3) strains, which are engineered for membrane protein expression

  • Employ a vector with an inducible promoter (e.g., T7) for controlled expression

  • Include a fusion tag (His6 or MBP) that facilitates purification without compromising function

  • Express at lower temperatures (16-20°C) to prevent inclusion body formation

  • Use mild induction conditions (0.1-0.5 mM IPTG) to reduce toxicity

The peripheral membrane association of Lgt, as demonstrated in previous studies , suggests that expression conditions should be optimized to maintain this association pattern. Adding phospholipids to the culture medium or during purification may help stabilize the recombinant enzyme. The surprising finding that Lgt can maintain activity in aqueous solutions after extraction provides flexibility in handling the protein during purification and functional studies .

What assay methods are available for measuring Lgt activity in recombinant systems?

Several methods have been developed to assess Lgt activity, with varying degrees of sensitivity and complexity. For researchers working with recombinant B. bacilliformis Lgt, the paper electrophoretic assay stands out as particularly valuable due to its directness, accuracy, and precision .

The paper electrophoretic assay works by:

  • Detecting the transfer of diacylglyceryl from radiolabeled phosphatidylglycerol to a synthetic peptide substrate

  • Separating the labeled product from unreacted substrate by electrophoresis

  • Quantifying the radioactivity in each fraction to determine reaction efficiency

A significant methodological advance is the recognition that Lgt can accept synthetic peptide substrates with short hydrophilic h-regions, unlike the prototypical substrates used in earlier studies . This demonstrates the enzyme's lack of substrate preference based on hydrophobicity and expands the range of potential synthetic substrates for activity assays.

For in vitro characterization of recombinant B. bacilliformis Lgt, researchers can employ a GFP-based assay that correlates enzyme activity with structural observations . This non-radioactive alternative may be preferable in some research settings and provides real-time monitoring of enzymatic activity.

How can researchers address solubility challenges when working with recombinant Lgt?

To optimize solubility of recombinant B. bacilliformis Lgt:

  • Exploit the peripheral membrane association by using mild extraction conditions with low ionic strength buffers rather than harsh detergents

  • Consider creating fusion proteins with solubility-enhancing tags like MBP (maltose-binding protein) or SUMO

  • Screen various detergents at low concentrations (0.01-0.1%) for extraction efficiency while maintaining enzyme activity

  • Incorporate phospholipids or lipid nanodiscs to mimic the native membrane environment

It's important to note that soluble Lgt extracted from membranes has been shown to maintain kinetic properties comparable to the membrane-bound form, although thermal stability may differ . Therefore, researchers should verify that their solubilized recombinant protein retains functional characteristics through activity assays before proceeding with structural or interaction studies.

How does Bartonella bacilliformis Lgt compare to Lgt proteins from other bacterial species?

Comparing B. bacilliformis Lgt to homologs from other bacteria provides valuable insights into conserved features and species-specific adaptations. While specific data on B. bacilliformis Lgt is limited in the search results, general patterns from comparative studies of bacterial Lgt proteins can inform research approaches.

The essential nature of Lgt is underscored by the fact that deletion of the lgt gene is lethal to most Gram-negative bacteria . This suggests strong selective pressure to maintain functional Lgt across diverse bacterial lineages. When analyzing B. bacilliformis Lgt in comparison to other species, researchers should consider:

  • Sequence conservation in catalytic domains versus variability in peripheral regions

  • Adaptations that might reflect the unique parasitic lifestyle of Bartonella species

  • Potential horizontal gene transfer events that might have influenced Lgt evolution

Homologous recombination is a common feature among bacterial species and has been documented in several studies of Bartonella strains from cats, rodents, and bats . This recombination can complicate phylogenetic inference but also provides valuable information about the evolution of genetic loci like lgt across Bartonella species. Researchers investigating evolutionary aspects of B. bacilliformis Lgt should employ multiple protein-coding loci to obtain robust phylogenetic signals .

What role does Lgt play in Bartonella pathogenesis and host-pathogen interactions?

Understanding the role of Lgt in Bartonella pathogenesis requires consideration of the enzyme's function in producing bacterial lipoproteins, which serve diverse functions in bacterial physiology and virulence. Bacterial lipoproteins fulfill wide-ranging and vital biological functions including maintenance of cell envelope architecture, insertion and stabilization of outer membrane proteins, nutrient uptake, transport, adhesion, invasion, and virulence .

Bartonella species are known to cause various human diseases, with Bartonella infection potentially affecting every organ system in the body when the bacteria cannot be effectively cleared . The role of Lgt-processed lipoproteins in these pathogenic processes is a critical area for investigation.

For researchers studying B. bacilliformis Lgt in the context of pathogenesis:

  • Identify which lipoproteins in B. bacilliformis are processed by Lgt and their putative roles in virulence

  • Investigate whether Lgt inhibition affects bacterial survival in host cell models

  • Examine if Lgt-processed lipoproteins are recognized by host immune receptors

  • Consider how Lgt activity might contribute to the organism's ability to "hide out" in red blood cells and endothelial cells

The fact that Bartonella is commonly transmitted to animals by fleas and can be found in three-quarters of stray cats along the coast of North Carolina suggests that Lgt-processed lipoproteins may play roles in vector-host transmission and environmental persistence.

How does genetic variation in the lgt gene affect functionality across Bartonella species?

Genetic variation in the lgt gene across Bartonella species may impact enzyme functionality, substrate specificity, and ultimately the composition of the bacterial lipoprotein profile. Researchers investigating this variation should consider:

  • Single nucleotide polymorphisms (SNPs) that may alter amino acid residues in catalytic or substrate-binding domains

  • Insertions or deletions that might affect protein folding or substrate access

  • Evidence of selective pressure on specific regions of the gene, which may indicate functional importance

For comprehensive analysis of lgt genetic variation, multiple genetic loci should be examined to provide sufficient phylogenetic resolution for delineation of bacterial species . The gltA, groEL, rpoB, and ftsZ genes, along with the ITS region, all have good discriminating power for Bartonella species identification . Researchers should incorporate these markers alongside lgt to place genetic variation in proper evolutionary context.

Homologous recombination, which has been documented in Bartonella strains, can lead to conflicts between phylogenetic signals from different genetic loci . For example, in some Bartonella samples, one locus may indicate the presence of one species while another locus suggests a different species . This phenomenon could potentially affect lgt as well, and researchers should be alert to inconsistencies that might indicate recombination events.

What strategies can be employed to develop specific inhibitors for Bartonella bacilliformis Lgt?

Developing specific inhibitors for B. bacilliformis Lgt represents an advanced research direction with potential therapeutic applications. The crystal structure of E. coli Lgt in complex with phosphatidylglycerol and the inhibitor palmitic acid provides a valuable template for structure-based drug design approaches .

To develop specific inhibitors for B. bacilliformis Lgt, researchers could:

  • Create a homology model of B. bacilliformis Lgt based on the E. coli crystal structure

  • Identify unique structural features that could be exploited for species-specific targeting

  • Perform virtual screening of compound libraries against the active site

  • Design transition-state analogs that mimic the diacylglyceryl transfer reaction

  • Develop lipid-based competitive inhibitors that target the phosphatidylglycerol binding site

The identification of critical residues like Arg143 and Arg239 that are essential for diacylglyceryl transfer provides specific targets for inhibitor design . Compounds that interact with these residues could potentially disrupt enzyme function with high specificity.

Testing candidate inhibitors would require the development of high-throughput screening assays. The paper electrophoretic assay method could be adapted for this purpose, or fluorescence-based assays could be developed to monitor Lgt activity in the presence of inhibitors.

How can advanced biophysical techniques be used to study the membrane dynamics of Lgt?

Advanced biophysical techniques offer powerful approaches to study the unique membrane dynamics of Lgt, particularly given its unusual peripheral and possibly reversible membrane association . These techniques can provide insights into how the enzyme interacts with lipid bilayers and how this interaction affects catalytic activity.

Researchers investigating B. bacilliformis Lgt membrane dynamics should consider:

  • Neutron reflectometry: To characterize the depth of Lgt penetration into lipid monolayers or bilayers

  • Fluorescence resonance energy transfer (FRET): To monitor protein-lipid interactions in real-time

  • Atomic force microscopy (AFM): To visualize Lgt distribution and organization in model membranes

  • Surface plasmon resonance (SPR): To measure binding kinetics between Lgt and various lipid compositions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To identify regions of Lgt that interact with the membrane

These techniques can help elucidate the mechanism whereby substrate and product enter and leave the enzyme laterally relative to the lipid bilayer, as proposed in structural studies . Understanding these dynamics is crucial for developing a complete model of Lgt function in the bacterial membrane.

The finding that Lgt has a peripheral membrane association contradicting its deduced transmembrane topology suggests that traditional models of membrane protein organization may not apply to this enzyme. Advanced biophysical techniques can help resolve this apparent contradiction and develop a more accurate model of Lgt topology.

What are the implications of Lgt inhibition for developing novel antimicrobial strategies against Bartonella infections?

Lgt inhibition represents a promising target for antimicrobial development against Bartonella infections, which can be difficult to treat with current antibiotics. The mainstream treatment approach currently requires weeks of multi-antibiotic therapies , highlighting the need for more effective and targeted treatments.

The essential role of Lgt in bacterial survival makes it an attractive target, as deletion of the lgt gene is lethal to most Gram-negative bacteria . Researchers exploring antimicrobial strategies targeting B. bacilliformis Lgt should consider:

  • Specificity: Designing inhibitors that selectively target bacterial Lgt without affecting human enzymes

  • Efficacy: Determining if Lgt inhibition alone is sufficient to clear Bartonella infections or if combination approaches are needed

  • Resistance development: Assessing the potential for bacteria to develop resistance to Lgt inhibitors

  • Delivery strategies: Developing methods to deliver inhibitors to Bartonella residing within red blood cells and endothelial cells

An important consideration is that Bartonella species can "hide out" in host cells for many infectious cycles , potentially avoiding exposure to antimicrobials. Effective Lgt inhibitors would need to penetrate these cellular refuges to reach the bacteria.

Given that Bartonella infections can affect every organ system in the body and lead to neurological, inflammatory, and chronic diseases , developing targeted antimicrobials based on Lgt inhibition could significantly improve treatment outcomes for patients with persistent infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.