Recombinant Bartonella grahamii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant B. grahamii nuoK is a recombinant fusion protein expressed in E. coli, comprising the full-length sequence (1–102 amino acids) of the native subunit K (nuoK) from B. grahamii. It is fused to an N-terminal His tag for affinity purification . The protein is lyophilized and stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

Key Attributes:

PropertyDetail
Gene NamenuoK (C6ADP9 in UniProt)
Source OrganismBartonella grahamii
Expression HostE. coli
TagN-terminal His tag
Molecular WeightNot explicitly stated (calculated from AA sequence: ~11.6 kDa)
Purity>90% (SDS-PAGE validated)
Storage-20°C/-80°C (long-term); 4°C for short-term working aliquots

Production and Purification

The recombinant protein is produced via bacterial expression and purified using nickel affinity chromatography due to its His tag.

ParameterDetail
Expression SystemE. coli (BL21(DE3) or similar)
InductionIPTG-mediated induction
PurificationNi-NTA affinity chromatography
YieldVaries by batch; typical yields not disclosed in available data
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol

Research Applications and Implications

While direct studies on B. grahamii nuoK are sparse, its recombinant form serves as a tool for:

  1. Structural Studies: Elucidating subunit interactions in NDH-1 complexes.

  2. Enzyme Activity Assays: Testing inhibitors targeting NADH-quinone oxidoreductase.

  3. Diagnostic Development: Potential antigen for serological detection, though current diagnostics prioritize gltA or rpoB .

Challenges and Opportunities:

  • Antimicrobial Targets: Inhibiting NDH-1 could disrupt B. grahamii’s energy metabolism, but bacterial resistance mechanisms remain unexplored.

  • Vaccine Research: Subunits like nuoK may be evaluated for immunogenicity in host-pathogen interactions.

Comparative Analysis with Related Subunits

While not directly studied, nuoK’s role in B. grahamii NDH-1 parallels that of analogous subunits in other bacteria:

SubunitOrganismRoleReferences
nuoKB. grahamiiPeripheral subunit; stabilizes complex
NQO6ParacoccusMembrane-associated; Fe-S cluster binding
nuoGBartonella spp.Target for PCR-based detection

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have a specific format preference, please indicate it in your order notes, and we will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please let us know, and we will prioritize developing the specified tag.
Synonyms
nuoK; Bgr_10420; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bartonella grahamii (strain as4aup)
Target Names
nuoK
Target Protein Sequence
MYIDITHYLTVSALMFTIGIAGIFLNRKNVIIILMSIELILLSVNLNFVAFSAFLHDLVG QIFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K and its significance in Bartonella species?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the bacterial respiratory chain complex I, essential for energy metabolism. In Bartonella species, this enzyme participates in electron transport and energy production critical for bacterial survival and pathogenicity. The enzyme is classified as EC 1.6.99.5 and is also known as NADH dehydrogenase I subunit K or NDH-1 subunit K . While most research has focused on other Bartonella species, the nuoK protein likely serves similar fundamental functions in B. grahamii's metabolism and adaptation to diverse host environments. Its conservation across Bartonella species suggests its essential nature for bacterial viability.

How is Bartonella grahamii genetically distinct from other Bartonella species?

Bartonella grahamii demonstrates significant genetic diversity compared to human and cat-associated Bartonella species. Research has revealed that B. grahamii exhibits strong geographic patterns in genomic structure, with higher sequence diversity in Asian isolates compared to those from Europe and North America . The species shows remarkably high recombination frequencies and significant variations in genome size . This genetic plasticity likely contributes to B. grahamii's ability to colonize a wide range of rodent hosts and potentially adapt to new environmental niches, including human hosts as demonstrated in case reports of human infection .

What are the optimal storage and handling conditions for recombinant Bartonella nuoK proteins?

Based on established protocols for similar recombinant Bartonella proteins, the following storage and handling guidelines are recommended:

  • Primary storage: -20°C for routine use

  • Long-term storage: -20°C or -80°C for extended preservation

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Handling precautions: Avoid repeated freeze-thaw cycles

  • Working aliquots: Store at 4°C for up to one week

These conditions help maintain protein stability and functional integrity for experimental applications such as enzyme assays, structural studies, and immunological investigations.

What molecular techniques are most effective for detection of Bartonella grahamii in environmental and clinical samples?

Detection of Bartonella species in environmental and clinical samples presents significant challenges due to their fastidious growth requirements and potential presence of PCR inhibitors. While bacterial culture remains the gold standard, its practicality is limited by the time and specialized conditions required .

Molecular approaches targeting the NADH dehydrogenase genes have shown superior sensitivity and specificity compared to traditional targets. Comparative analysis of different primer sets reveals the following efficacy in field samples:

Primer setColombian ticks positive (%) (n=61)Nepal rodent livers positive (%) (n=24)
gltA set0 (0%)2 (9%)
ftsZ72 set1 (2%)10 (42%)
nuoG set7 (11%)18 (75%)

The data demonstrates that primers targeting the NADH dehydrogenase gamma subunit (nuoG) significantly outperform other commonly used targets in detecting Bartonella in both vector (ticks) and mammalian host (rodent) samples . By extension, developing primers specific to the nuoK gene region of B. grahamii could provide a similarly effective detection method with species specificity.

How should researchers approach primer design for specific amplification of B. grahamii nuoK?

Effective primer design for B. grahamii nuoK amplification should follow these methodological steps:

  • Perform whole-genome scanning of multiple B. grahamii isolates to identify conserved regions within the nuoK gene

  • Compare sequences across Bartonella species and potential host/vector organisms to identify B. grahamii-specific regions

  • Design primer pairs that maintain at least a 2-base specificity among the complete sequence database

  • Target amplicon sizes less than 400 bp for optimal PCR efficiency

  • Ensure primer melting temperatures (Tms) are within 2°C of each other

  • Test primers against both reference strains and field-collected samples

  • Validate specificity through sequencing of PCR products

This approach addresses the challenges of cross-reactivity with host DNA and related bacterial species while maximizing detection sensitivity. When designing nuoK-specific primers, researchers should particularly focus on variable regions that differentiate B. grahamii from other Bartonella species to ensure specificity.

What is the evidence for Bartonella grahamii as a human pathogen, and how might nuoK contribute to its pathogenicity?

B. grahamii has been confirmed as a zoonotic pathogen capable of causing human infection. The first definitively confirmed human case (verified through multilocus sequence typing) presented with symptoms resembling cat scratch disease, traditionally associated with B. henselae infection . The patient developed symptoms following exposure to rodents, consistent with B. grahamii's natural reservoir.

Earlier cases included a reported instance of neuroretinitis in 1999 and a case of bilateral retinal artery branch occlusions in an immunocompetent patient . The pathogen appears particularly significant for immunocompromised individuals, as demonstrated in a case involving a patient with chronic lymphocytic leukemia .

While the specific role of nuoK in B. grahamii pathogenesis has not been directly established, NADH-quinone oxidoreductase complexes are essential for bacterial energy metabolism and adaptation to host environments. As a membrane-associated protein, nuoK likely contributes to:

  • Bacterial survival under the varying metabolic conditions encountered during infection

  • Adaptation to the low-oxygen microenvironments within host tissues

  • Energy production necessary for bacterial replication and virulence factor expression

  • Potentially serving as an antigenic target recognized by the host immune system

Research methodologies to investigate nuoK's role in pathogenicity would include creating isogenic mutants with nuoK deletions and evaluating their virulence in appropriate animal models.

How does geographic variation in B. grahamii impact its genetic diversity and potential virulence?

B. grahamii exhibits pronounced geographic patterns in its genetic diversity. Research has demonstrated:

  • Lower sequence divergence in European and North American populations compared to Asian isolates

  • Evidence of multiple recombination events specifically among Asian strains

  • Significant variations in genome size across different geographic regions

These patterns suggest that B. grahamii is undergoing different evolutionary pressures in various parts of the world, which may influence its host range and pathogenic potential. The increased recombination frequency in Asian strains might facilitate more rapid adaptation to new hosts or environmental conditions.

Research methodologies to explore these variations should include:

  • Whole genome sequencing of isolates from diverse geographic origins

  • Comparative genomic analysis focusing on virulence-associated genes

  • Assessment of host range and specificity across geographic regions

  • Experimental infection studies using isolates from different geographic origins

What experimental approaches can address the challenges of expressing and purifying recombinant B. grahamii nuoK for structural studies?

The hydrophobic nature of membrane proteins like nuoK presents significant challenges for expression and purification. Based on protocols for similar proteins, researchers should consider:

  • Expression system optimization:

    • Test multiple expression systems (E. coli, yeast, insect cells)

    • Evaluate different fusion tags (His, MBP, GST) to enhance solubility

    • Optimize codon usage for the expression host

    • Consider cell-free expression systems for membrane proteins

  • Purification strategy:

    • Use detergent screening to identify optimal solubilization conditions

    • Employ tag-based affinity chromatography followed by size exclusion

    • Consider lipid nanodiscs or amphipols to maintain native structure

    • Validate proper folding through circular dichroism spectroscopy

  • Structural analysis:

    • Attempt crystallization trials with various detergents and lipids

    • Consider cryo-electron microscopy for membrane protein complexes

    • Use computational modeling to predict structure based on homologous proteins

    • Perform functional assays to correlate structure with enzymatic activity

How can nuoK be utilized in developing novel detection methods for B. grahamii infections?

The demonstrated success of nuoG-based detection of Bartonella species suggests that nuoK could similarly serve as an effective target for specific detection of B. grahamii. Future research directions should explore:

  • Development of multiplex PCR assays incorporating nuoK alongside other markers

  • Design of nuoK-specific monoclonal antibodies for immunodiagnostic applications

  • Creation of recombinant nuoK protein standards for quantitative assays

  • Evaluation of nuoK-based detection in various clinical sample types

  • Implementation of isothermal amplification methods targeting nuoK for field diagnostics

Such approaches would address current limitations in B. grahamii detection, which has historically been challenging due to its fastidious growth requirements and cross-reactivity with other bacterial species in molecular assays.

What is the potential for nuoK as a therapeutic target in treating Bartonella infections?

NADH-quinone oxidoreductase represents a promising therapeutic target due to its essential role in bacterial metabolism and structural differences from mammalian counterparts. Research exploring nuoK as a drug target should consider:

  • High-throughput screening of compound libraries for specific inhibitors

  • Structure-based drug design targeting unique features of bacterial nuoK

  • Repurposing of existing respiratory chain inhibitors with established safety profiles

  • Development of combination therapies targeting multiple components of bacterial energy metabolism

  • Assessment of resistance development potential through in vitro passage experiments

The unique sequence and structural features of Bartonella nuoK could provide the specificity necessary for targeted antimicrobial development with minimal effects on host cells.

How might environmental and demographic factors influence the evolution and host adaptation of B. grahamii nuoK?

The observed geographic patterns in B. grahamii genetic diversity suggest that environmental and demographic factors significantly influence its evolution. Future research should investigate:

  • The correlation between rodent population dynamics and B. grahamii genetic diversity

  • The impact of climate and ecological factors on B. grahamii adaptation

  • The role of vector distribution in shaping B. grahamii population structures

  • How human encroachment into rodent habitats influences potential zoonotic transmission

Understanding these factors will provide critical insights into the evolutionary trajectory of B. grahamii and its potential emergence as a more significant human pathogen.

What technological advances are needed to accelerate research on B. grahamii nuoK and related respiratory enzymes?

Advancing our understanding of B. grahamii nuoK will require several technological innovations:

  • Improved culture methods for Bartonella species to facilitate genetic manipulation

  • Development of B. grahamii-specific genetic tools for targeted mutagenesis

  • Advanced imaging techniques for visualizing respiratory complexes in situ

  • High-throughput screening platforms for identifying nuoK inhibitors

  • Computational approaches for predicting protein interactions within the respiratory complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.