Recombinant Bartonella henselae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; BH04110; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
atpB
Target Protein Sequence
MTSHAPDPVHQFEVSRLINISIGNMDLSFTNVSFFIVATVVVSSVFLFISSSSRGLVPTR MQSVSEMAYEFVASTLRESSGVQGMQFFPLVFSLFTFILVANFIGLFPYFYTITSQIMIT FSLAMLVIFTVISYGFYKHGVGFLKLFVPSGVPVLILPLVTMIEVISFFSRPISLSLRLF ANMLAGHITLKVFSGFIVSMIGIGIMGVGGSILPLIMTVAITALEFLVAFLQAYVFTVLT CMYLNDAVHPGH
Uniprot No.

Target Background

Function
Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
Database Links

KEGG: bhe:BH04110

STRING: 283166.BH04110

Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ATP synthase subunit a in Bartonella henselae?

ATP synthase subunit a (atpB) in Bartonella henselae functions as a critical component of the F₀ portion of the F₁F₀-ATP synthase complex, facilitating proton translocation across the bacterial membrane. This protein plays an essential role in energy production through oxidative phosphorylation, allowing B. henselae to generate ATP for cellular processes. The protein is particularly important during the transition between arthropod vector and mammalian host environments, where energy demands fluctuate substantially. Like other intracellular pathogens, B. henselae must adapt its energy metabolism to survive within host cells, making atpB a potentially important factor in its persistence during infection .

How does recombinant B. henselae atpB differ from native atpB?

Recombinant B. henselae ATP synthase subunit a (atpB) is produced through heterologous expression systems, typically in E. coli, following similar methods to those used for other Bartonella proteins. The recombinant protein generally maintains the primary sequence of native atpB but may include affinity tags (such as His-tags) to facilitate purification. While the core structure remains intact, recombinant atpB may exhibit differences in post-translational modifications compared to the native form. These differences should be considered when using recombinant atpB for structural studies or functional assays, as they might affect protein folding or activity. Expression systems similar to those used for other Bartonella proteins, like the pET expression system employed for BafA protein domains, are typically utilized for atpB production .

What are the optimal storage conditions for recombinant B. henselae atpB?

Recombinant B. henselae atpB should be stored following protocols similar to other bacterial membrane proteins. For short-term storage (1-2 weeks), the protein can be maintained at 4°C in an appropriate buffer system containing stabilizing agents. For long-term storage, aliquoting the protein and storing at -80°C is recommended to prevent freeze-thaw damage. The addition of glycerol (10-15%) can help maintain protein stability during freezing. Proper buffer selection is crucial, typically phosphate-buffered saline (PBS) at pH 7.4 with potential additions of reducing agents like DTT or β-mercaptoethanol if the protein contains critical cysteine residues. When preparing the protein for experimental use, it's important to maintain the protein in conditions that preserve its native conformation and prevent aggregation.

What are the most effective expression systems for producing recombinant B. henselae atpB?

The most effective expression systems for producing recombinant B. henselae atpB typically involve E. coli strains optimized for membrane protein expression. The pET expression system with BL21(DE3) or C41(DE3)/C43(DE3) E. coli strains (which are better suited for membrane protein expression) often yields satisfactory results. For atpB production, researchers should consider approaches similar to those used for other Bartonella proteins, where specific vectors like pET-28b have been successfully employed for expressing protein domains . The expression protocol typically involves:

  • Cloning the atpB gene into an appropriate expression vector with a suitable tag (His-tag or Strep-tag)

  • Transformation into an expression host

  • Induction with IPTG at reduced temperatures (16-25°C) to enhance proper folding

  • Extended expression periods (overnight to 24 hours)

  • Careful membrane fraction isolation followed by detergent solubilization

The choice of detergent is critical for maintaining protein stability and functionality, with mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) often preferred for ATP synthase components.

What purification strategies yield the highest purity recombinant B. henselae atpB?

Purification of recombinant B. henselae atpB typically follows a multi-step chromatography approach. The recommended purification strategy includes:

  • Affinity chromatography as the initial capture step (Ni-NTA for His-tagged proteins or Strep-Tactin for Strep-tagged proteins)

  • Ion exchange chromatography as an intermediate purification step

  • Size exclusion chromatography as a final polishing step

Throughout the purification process, the protein should be maintained in a buffer containing an appropriate detergent above its critical micelle concentration to prevent aggregation. A typical purification workflow might resemble that used for other Bartonella membrane proteins, employing methods similar to those used for purifying BafA protein . The addition of stabilizing agents such as glycerol (10%) and careful pH control are essential for maintaining protein integrity during purification. Yield and purity should be assessed at each step using SDS-PAGE and Western blotting with antibodies specific to the target protein or the affinity tag.

How can researchers verify the structural integrity of purified recombinant atpB?

Verifying the structural integrity of purified recombinant B. henselae atpB requires a combination of biophysical and biochemical approaches:

  • Circular Dichroism (CD) spectroscopy to assess secondary structure content

  • Thermal shift assays to evaluate protein stability

  • Limited proteolysis to examine folding quality

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm proper oligomeric state

  • Functional assays measuring ATP hydrolysis activity (in reconstituted systems)

Native-PAGE or Blue Native-PAGE can provide information about the assembly state of the protein. For membrane proteins like atpB, reconstitution into liposomes or nanodiscs followed by proton translocation assays may be necessary to confirm functional integrity. When analyzing recombinant atpB, researchers should compare results to known properties of ATP synthase subunits from related bacteria to identify potential structural abnormalities that might affect experimental outcomes.

How is recombinant B. henselae atpB used in structural biology studies?

Recombinant B. henselae atpB serves as a valuable tool in structural biology studies focused on understanding the architecture and function of bacterial ATP synthases. Researchers employ the following approaches:

For successful structural studies, researchers must optimize detergent conditions or consider reconstitution into membrane mimetics like nanodiscs or amphipols. When studying atpB in isolation, it's important to consider that its native conformation may depend on interactions with other ATP synthase subunits. Therefore, co-expression or reconstitution with partner subunits might be necessary for obtaining physiologically relevant structural data. Similar approaches have been used successfully with other Bartonella membrane proteins .

What role does recombinant atpB play in developing diagnostic tools for Bartonella infections?

Recombinant B. henselae atpB has potential applications in developing serological diagnostic tools for Bartonella infections, following similar principles to those established for other Bartonella antigens like Pap31. The development process typically involves:

  • Evaluation of recombinant atpB's antigenicity using patient sera

  • Assessment of sensitivity and specificity in ELISA or Western blot formats

  • Comparison with existing diagnostic antigens

  • Validation with clinically confirmed samples

Researchers have successfully used recombinant Bartonella proteins in ELISA formats with excellent discrimination between positive and negative patient samples, as demonstrated with Pap31 . Similar approaches could be applied to atpB if it proves to be immunogenic during B. henselae infections. The development of rapid diagnostic tests using recombinant atpB would follow protocols similar to those established for other Bartonella antigens, potentially addressing the need for improved diagnostic tools for bartonellosis in both clinical and research settings.

How can researchers use atpB to study B. henselae energy metabolism during infection?

Researchers can employ recombinant B. henselae atpB to investigate the bacterium's energy metabolism adaptations during infection through several experimental approaches:

  • Gene expression studies using qRT-PCR to monitor atpB expression levels under different infection conditions

  • Protein-protein interaction studies to identify regulatory partners

  • Site-directed mutagenesis to create atpB variants for functional studies

  • Development of atpB-specific antibodies for immunolocalization during infection

By combining these approaches with infection models, researchers can determine how B. henselae modulates ATP synthesis during different stages of infection. Particularly interesting is how the bacterium adapts its energy metabolism when transitioning between the arthropod vector and mammalian host, or when exposed to host defense mechanisms. Understanding these adaptations could reveal how B. henselae persists in host cells and potentially identify new targets for therapeutic intervention. Similar approaches have been used to study other Bartonella virulence factors, such as the BatR/BatS two-component regulatory system that helps the bacterium respond to environmental pH changes during infection .

How does atpB contribute to B. henselae adaptation to different host environments?

ATP synthase subunit a (atpB) likely plays a critical role in B. henselae's adaptation to varying host environments through modulation of energy production. In the context of the bacterium's complex lifecycle involving arthropod vectors and mammalian hosts, atpB may function as:

  • A responsive element in the bacterium's pH-sensing network, potentially regulated by the BatR/BatS two-component system that serves as a pH sensor in Bartonella

  • A component of the adaptive response to different oxygen tensions encountered in various host niches

  • A participant in metabolic reprogramming during transitions between host environments

The regulation of ATP synthase components appears to be an important aspect of bacterial adaptation to host environments. B. henselae likely modulates atpB expression or activity to optimize energy production under different conditions, such as the neutral pH of mammalian blood versus the potentially more alkaline environment of arthropod vectors. This adaptation mechanism would be consistent with the known pH-responsive regulation systems in Bartonella, where genes are upregulated at neutral pH and repressed at alkaline pH .

What structural features of atpB contribute to proton translocation and how can these be studied?

The proton translocation function of atpB depends on specific structural features that can be investigated through detailed molecular approaches:

  • Conserved transmembrane helices that form part of the proton channel

  • Critical charged residues (particularly arginine and aspartate) that participate in proton transfer

  • Specific interactions with other F₀ subunits (particularly subunit c)

To study these features, researchers can employ:

ApproachInformation ObtainedTechnical Considerations
Site-directed mutagenesisFunctional importance of specific residuesRequires functional reconstitution system
Hydrogen-deuterium exchange mass spectrometrySolvent accessibility and dynamicsRequires specialized equipment and expertise
Molecular dynamics simulationsDynamic behavior of proton pathRelies on accurate structural models
Cross-linking studiesSubunit interfaces and interactionsRequires optimization of cross-linking conditions

Understanding the structural basis of atpB's proton translocation is complicated by the protein's membrane-embedded nature and its functional dependence on other ATP synthase components. Therefore, studies often need to consider the ATP synthase complex as a whole rather than atpB in isolation. Advanced structural techniques similar to those used for other membrane proteins in Bartonella could provide insights into atpB's functional mechanisms .

How does atpB interact with other ATP synthase components in B. henselae?

The interactions between atpB and other ATP synthase components in B. henselae form the foundation of a functional F₁F₀-ATP synthase complex. These interactions can be characterized using:

  • Co-immunoprecipitation assays with tagged atpB to identify interacting partners

  • Bacterial two-hybrid systems to screen for specific protein-protein interactions

  • Cross-linking mass spectrometry to map interaction interfaces

  • Reconstitution studies with purified components to assess functional interactions

AtpB likely interacts primarily with the c-ring of the F₀ sector and forms part of the stator that connects to the F₁ sector through interactions with subunits b and δ. These interactions are essential for coupling proton translocation to ATP synthesis. The methodologies for studying these interactions would be similar to those used for investigating other protein complexes in Bartonella, such as the approaches used to study the VirB/VirD4 T4SS complex components . Understanding these interactions could provide insights into the assembly and regulation of the ATP synthase complex in B. henselae and potentially reveal unique features that might be exploited for targeted interventions.

How does B. henselae atpB compare to homologous proteins in other pathogenic bacteria?

B. henselae atpB shares structural and functional similarities with homologous proteins in other pathogenic bacteria, but also exhibits species-specific characteristics:

Bacterial SpeciesatpB SimilarityFunctional DifferencesEvolutionary Implications
Escherichia coliHigh sequence conservation in functional domainsWell-characterized, benchmark for comparisonConserved core function across diverse bacteria
Other Bartonella species (e.g., B. quintana)Very high sequence identity (>90%)Similar adaptations to host environmentsRecent divergence within genus
Brucella speciesModerate to high sequence similaritySimilar intracellular lifestyle requirementsCommon adaptations in related α-proteobacteria
Rickettsia speciesModerate sequence similarityHighly reduced genome, specialized metabolismParallel adaptations to intracellular lifestyle

How does atpB function differ between B. henselae and B. quintana?

While B. henselae and B. quintana are closely related species with similar lifestyles, their atpB proteins may exhibit subtle functional differences reflecting their distinct host preferences and ecological niches:

These differences may contribute to the distinct pathogenicity profiles of these two Bartonella species. B. henselae primarily infects cats and causes cat scratch disease in humans, while B. quintana is adapted to human hosts and causes trench fever. Research approaches similar to those used to compare other proteins between these species, such as the comparative analysis of BafA proteins that revealed similar angiogenic activities despite sequence differences , would be valuable for understanding species-specific adaptations in energy metabolism.

What is the role of atpB in B. henselae pathogenicity and host cell interaction?

While atpB's primary function relates to energy metabolism, it may contribute to B. henselae pathogenicity through several mechanisms:

  • Supporting bacterial survival during host cell invasion and intracellular persistence

  • Maintaining energy homeostasis during stress conditions encountered within the host

  • Potentially contributing to membrane potential maintenance, which may influence other virulence mechanisms

  • Possibly participating in pH adaptation during host cell infection

Could atpB serve as a target for novel antimicrobial strategies against Bartonella infections?

ATP synthase components represent potential targets for antimicrobial development due to their essential role in bacterial energy metabolism. Several factors support considering atpB as a therapeutic target:

  • Essential function: Disruption of ATP synthesis would severely compromise bacterial survival

  • Accessibility: The F₀ sector of ATP synthase is embedded in the bacterial membrane

  • Structural differences: Despite conservation, bacterial ATP synthases differ sufficiently from human counterparts to allow selective targeting

Research approaches to explore atpB as a therapeutic target include:

ApproachDescriptionPotential Outcomes
High-throughput screeningTesting compound libraries for inhibition of ATP synthase activityIdentification of hit compounds for further development
Structure-based drug designUsing structural information to design specific inhibitorsRationally designed inhibitors with improved specificity
Peptide inhibitorsDevelopment of peptides that disrupt atpB interactionsPotentially specific inhibitors that block assembly or function
ImmunotherapyUsing atpB as a target for antibody-based therapiesPossible approach for extracellular bacteria or exposed epitopes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.