Recombinant Bartonella henselae Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties

Recombinant B. henselae PlsY is produced in E. coli with a His tag for purification . Key specifications include:

PropertyDetails
UniProt IDQ6G3F5
Amino Acid SequenceMNEGEILFQFTTWLIFLISYLIGSIPFGLLLTKLAKLGDVRTIGSGNIGATNVLRTGNKKVAALTLLCDILKG...
Molecular Weight~25 kDa (predicted for 1-211 aa)
Purity>90% (SDS-PAGE)
StorageTris/PBS-based buffer with 50% glycerol or 6% trehalose; store at -20°C/-80°C
Expression HostEscherichia coli
InhibitionNoncompetitive inhibition by palmitoyl-CoA

Catalytic Mechanism

PlsY operates via a two-step pathway:

  1. Acyl-phosphate Formation: Acyl groups from acyl-acyl carrier protein (acyl-ACP) are converted to acyl-phosphate by PlsX.

  2. Acyl Transfer: PlsY transfers the acyl group from acyl-phosphate to glycerol-3-phosphate, forming LPA .

The HX<sub>4</sub>D motif in Motif 3 facilitates proton abstraction from glycerol-3-phosphate, enabling nucleophilic attack on the acyl-phosphate substrate . This mechanism is analogous to serine hydrolases, leveraging a histidine-aspartate dyad for catalysis .

Research Applications

  • Lipid Metabolism Studies: Used to investigate bacterial phospholipid biosynthesis and membrane biogenesis .

  • Antimicrobial Target Exploration: Potential drug target due to its essential role in bacterial viability .

  • Enzyme Kinetics: Mutagenesis studies (e.g., glycine-to-alanine substitutions in Motif 2) reveal substrate-binding dynamics .

Functional Insights from Mutagenesis

  • Motif 2 Mutations: Glycine-to-alanine substitutions in the phosphate-binding loop (Motif 2) impair glycerol-3-phosphate binding, confirming its role in substrate recognition .

  • Motif 3 Disruption: Histidine or asparagine mutations reduce catalytic activity by >90%, while glutamate mutations destabilize the protein .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
plsY; BH08180; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
plsY
Target Protein Sequence
MNEGEILFQFTTWLIFLISYLIGSIPFGLLLTKLAKLGDVRTIGSGNIGATNVLRTGNKK VAALTLLCDILKGTLVILVIKFLTDPIENNIFISLAGFFAFLGHLFPVWLKFKGGKGVAT YLGVCLGLYWPAAIVFITAWIVLFLITRYSSLSALIAVIITPIFVHFSYPYLYAHCILVI MSLLVMIKHHANIGRLLVGKESKIGTQNGGK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: bhe:BH08180

STRING: 283166.BH08180

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bartonella henselae Glycerol-3-phosphate acyltransferase (plsY) and its function?

Glycerol-3-phosphate acyltransferase (plsY) in Bartonella henselae is a critical enzyme in the phospholipid biosynthesis pathway. It functions as an acyl-phosphate-glycerol-3-phosphate acyltransferase, catalyzing the transfer of acyl groups to glycerol-3-phosphate (G3P) to form lysophosphatidic acid, which is a precursor for bacterial membrane phospholipid synthesis . The protein plays an essential role in bacterial membrane formation, particularly in intracellular pathogens like Bartonella henselae where lipid metabolism is critical for survival and pathogenicity.

What is the significance of plsY in the context of Bartonella evolution?

The plsY gene is part of the phospholipid biosynthesis pathway that has undergone significant evolutionary changes in Bartonella species. While some critical genes in this pathway (such as gpsA, which encodes NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) have experienced patterns of gene loss and horizontal gene transfer, plsY has been maintained in Bartonella henselae . This conservation suggests that plsY fulfills an essential function that cannot be easily replaced through alternative metabolic pathways, particularly in the context of Bartonella's adaptation to intracellular lifestyle in mammalian hosts.

How does Bartonella's evolutionary loss of related phospholipid pathway genes affect plsY function?

Bartonella species have undergone significant evolutionary changes in their phospholipid biosynthesis pathway. Phylogenetic analysis shows that Bartonella species experienced ancestral loss of glpK (glycerol kinase) and the Glp system (encoded by genes glpS-T-P-Q-U-V) that imports extracellular glycerol, followed by loss of gpsA in eubartonellae . Despite these losses, plsY has been retained, suggesting its critical role in phospholipid synthesis when using host-derived G3P. This evolutionary pattern indicates that plsY may function differently in Bartonella compared to other bacteria, as it must operate in a metabolic context where the bacterium relies on host-derived G3P rather than synthesizing it from glucose or glycerol . Researchers studying plsY function must consider this unique evolutionary context when designing experiments.

What are the implications of plsY conservation in the context of Bartonella's intracellular lifestyle?

The conservation of plsY in Bartonella, despite the loss of other phospholipid pathway genes, strongly suggests that this enzyme plays a crucial role in the bacterium's intracellular adaptation. The ancestral loss of glpK and the Glp system, followed by gpsA loss, indicates that ancestral eubartonellae likely relied directly on host-derived G3P, which is an intermediate metabolite in intracellular biochemical pathways .

G3P does not occur stably in extracellular environments such as blood, suggesting that Bartonella's phospholipid metabolism, including plsY function, evolved specifically for intracellular existence . This has significant implications for understanding Bartonella pathogenesis and host-pathogen interactions, as the bacterium must have developed mechanisms to access and utilize host G3P for membrane synthesis, with plsY potentially serving as a key enzyme in this process.

How does plsY function differ between immunocompetent and immunocompromised host models?

Research comparing Bartonella henselae infection in immunocompetent Swiss Webster (SW) mice versus immunocompromised SCID/beige mice shows significant differences in bacterial persistence and tissue distribution . While the studies don't directly examine plsY function, they provide important context for researchers investigating plsY in different host environments.

In immunocompetent SW mice, B. henselae DNA was rarely detected in tissues (only 1 out of 27 tissues tested positive), suggesting limited bacterial replication or rapid clearance . In contrast, in immunocompromised SCID/beige mice, B. henselae DNA was detected in multiple tissues, with increasing positive tissues over time . This suggests that:

  • plsY function and phospholipid biosynthesis may face different selective pressures in immunocompetent versus immunocompromised hosts

  • Studies of recombinant plsY should consider the immune status of the host model when interpreting results

  • The metabolic environment affecting plsY substrate availability may differ between these models

What are the optimal conditions for expressing recombinant B. henselae plsY protein?

Based on the available data, recombinant B. henselae plsY protein has been successfully expressed in E. coli expression systems . The protein is typically expressed with an N-terminal His-tag to facilitate purification.

Optimal expression conditions include:

  • Expression system: E. coli (specific strain information may vary by laboratory)

  • Tag configuration: N-terminal His-tag

  • Protein solubility: As a membrane-associated enzyme, plsY may exhibit solubility challenges that require optimization of detergent conditions

  • Storage: The lyophilized protein should be stored at -20°C/-80°C, with reconstituted protein stored at 4°C for up to one week

  • Reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol for long-term storage

Researchers should avoid repeated freeze-thaw cycles as these may compromise protein function.

What methodological approaches can be used to study plsY activity in the context of Bartonella intracellular lifestyle?

Studying plsY activity in the context of Bartonella's intracellular lifestyle requires specialized approaches:

  • Cell culture infection models: Since Bartonella henselae is more successfully isolated in living cell lines than on blood agar (particularly for gpsA-less lineages) , researchers should consider using cell culture systems to study plsY function in a physiologically relevant context.

  • G3P utilization assays: Given that Bartonella likely relies on host-derived G3P for phospholipid synthesis , researchers can design assays that track labeled G3P incorporation into bacterial membranes to assess plsY activity.

  • Animal models: The SCID/beige mouse model appears to support more robust B. henselae infection compared to immunocompetent mice , making it a potentially better system for studying plsY function in vivo.

  • Molecular detection methods: PCR-based approaches targeting the plsY gene can be used alongside methods for detecting the entire bacterium, such as nested PCR of the vOMP1 gene .

  • Comparative analysis with related enzymes: Studying plsY in the context of other Bartonella species that have different evolutionary histories regarding phospholipid pathway genes may provide insights into its specific adaptations.

What techniques are most effective for detecting B. henselae in research samples when studying plsY function?

Detection of B. henselae in research samples is critical for studying plsY function in the context of infection. Based on current methodologies, the following approaches are recommended:

How can researchers address challenges with recombinant plsY protein solubility and activity?

As a membrane-associated enzyme involved in phospholipid biosynthesis, plsY may present solubility challenges that impact experimental outcomes. Researchers can address these issues through:

  • Optimized buffer conditions: Use of Tris/PBS-based buffers with 6% trehalose at pH 8.0 has been reported for storage of recombinant plsY . For functional assays, buffer optimization may require additional detergents or lipid components.

  • Activity preservation: Addition of glycerol (5-50% final concentration) is recommended for long-term storage . Aliquoting the protein to avoid repeated freeze-thaw cycles is essential for maintaining activity.

  • Substrate availability: Since plsY requires both acyl-phosphate and G3P as substrates, ensuring appropriate concentrations of both in functional assays is critical.

  • Alternative expression strategies: If solubility remains challenging, alternative approaches such as membrane-fraction preparations rather than purified protein may better preserve the native environment and activity of plsY.

What are the potential pitfalls when interpreting plsY function in the context of Bartonella's evolutionary history?

When studying plsY function in the context of Bartonella's unique evolutionary history, researchers should be aware of several potential pitfalls:

  • Evolutionary context: Bartonella species have undergone significant gene losses in the phospholipid pathway, including glpK, the Glp system, and in some lineages, gpsA . Interpretations of plsY function must consider this altered metabolic context.

  • Host dependency: Due to these gene losses, Bartonella likely relies on host-derived G3P for membrane synthesis . Experimental designs that don't account for this host dependency may yield misleading results about plsY function.

  • Lineage-specific differences: Different Bartonella lineages have distinct evolutionary histories regarding phospholipid pathway genes. For example, lineage 3 bartonellae (B. rochalimae, B. clarridgeiae, B. sp. 1-1C, and B. sp. AR 15-3) lack gpsA , which may affect how plsY functions in these species compared to others.

  • In vitro versus in vivo discrepancies: The slow growth of gpsA-less Bartonella lineages on blood agar compared to their more successful isolation in living cell lines suggests that in vitro studies may not fully recapitulate the natural context of plsY function.

How should researchers design experiments to study the relationship between plsY function and Bartonella pathogenesis?

To effectively investigate the relationship between plsY function and Bartonella pathogenesis, researchers should consider the following experimental design principles:

  • Appropriate model systems: The SCID/beige mouse model appears more suitable than immunocompetent models for studying B. henselae infection dynamics . For cellular models, consider that different Bartonella lineages may show different growth characteristics in vitro versus in cell culture .

  • Comprehensive tissue analysis: When studying pathogenesis in animal models, examine multiple tissues systematically, as B. henselae distribution varies significantly by tissue and time point post-infection . The tissue distribution table from search result provides guidance:

TissuesSW Day 10SW Day 20SW Day 30SCID/beige Day 10SCID/beige Day 20SCID/beige Day 30
Ear000001
Heart100100
Bladder000012
Spleen000100
TTJ000001
LN000010
Brain000013
Liver000000
Bone Marrow000001
  • Integrative approaches: Combine molecular studies of plsY function with broader analyses of Bartonella phenotypes, such as intracellular survival, membrane integrity, and virulence, to establish causal relationships.

  • Consideration of metabolic context: Design experiments that account for Bartonella's unique phospholipid metabolism, particularly its likely dependence on host-derived G3P rather than de novo synthesis from glucose or glycerol .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.