Recombinant Bartonella henselae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bartonella henselae Large-Conductance Mechanosensitive Channel (MscL)

The bacterial mechanosensitive channel of large conductance (MscL) acts as an emergency release valve, discharging cytoplasmic solutes when the cell experiences osmotic stress . Inappropriate opening of the MscL's large pore can harm the cell, leading to speculation that it could be a potential antibiotic target . MscL is one of the most studied mechanosensitive channels .

MscL as an Antibiotic Target

Due to its role in cell survival under osmotic stress, MscL is considered a viable antibiotic target . High-throughput screening has identified compounds that slow bacterial growth in an MscL-dependent manner, suggesting that targeting MscL could lead to new antibacterial strategies .

Compounds Modulating MscL Activity

Two sulfonamide compounds, 011 and 120, have been identified as modulators of MscL activity . Compound 011 appears highly specific, decreasing growth only in cells expressing MscL, not MscS . Compound 120 showed decreased growth regardless of whether MscL or MscS from E. coli was expressed, with greater decreases in growth observed with MscS .

4.1. Effects on Channel Activity

Eco-MscL channel activity increased when compound 011 was presented from the periplasm, and when presented from the cytoplasm . MscL channel activity also significantly increased when compound 120 was presented from the periplasm, but had no significant effect from the cytoplasm .

Bartonella henselae Pap31 and its Diagnostic Utility

Bartonella henselae Pap31, an outer membrane protein, is an important virulence factor for bacterial attachment and colonization of mammalian cells, promoting the establishment of B. henselae infection in the host . It is homologous to the hemin-binding protein family of B. quintana and is involved in heme acquisition .

5.1. Diagnostic evaluation of recombinant Pap31

Recombinant Pap31 resulted in 72% sensitivity and 61% specificity at a cutoff value of 0.215 . The sensitivity and specificity of rPap31-NTD was 89% and 56%, respectively, at a cutoff value of 0.7985, as determined at the maximum Youden index value . A higher cutoff value of 1.366 (trade-off between sensitivity and specificity) for rPap31-NTD resulted in 39% sensitivity and 94% specificity .

Table: Comparison of MscL Modulating Compounds

CompoundSpecificityMechanism of ActionEffect on MscL Activity
011MscLOnly cells expressing MscL, not MscS, showed decreased growth when this compound was added .MscL channel activity increased when presented from the periplasm, and when presented from the cytoplasm .
120MscL and MscSShowed decreased growth regardless of whether MscL or MscS from E. coli was expressed, with greater decreases in growth observed with MscS . Consistent with intercalating in the membrane, adding tension, and slowing growth of cells .MscL channel activity also significantly increased when presented from the periplasm but had no significant effect from the cytoplasm .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; BH03860; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNMIDLAIGVIIGGAFGGLVNSIVNDIFMPIIGLITGGIDFSNMFIQLA GEKQATLSAAKAAGATISYGNFITLLINFLIIAWVLFLFVKSMNKIRRKQEEEETSKKMS LEQQLLSEIRDLLAKKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links

KEGG: bhe:BH03860

STRING: 283166.BH03860

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bartonella henselae and why is its MscL protein significant for research?

Bartonella henselae is a gram-negative bacterium primarily known as the causative agent of cat-scratch disease (CSD) in humans. It is characterized by regional lymphadenopathy in immunocompetent individuals and can cause more severe vasculoproliferative disorders in immunocompromised hosts . The bacterium has a genome of approximately 1.93 million base pairs and exhibits unique pathogenic mechanisms, including the ability to invade and persist in various cell types such as endothelial cells, erythrocytes, and mesenchymal stromal cells (MSCs) .

The Large-conductance mechanosensitive channel (MscL) in B. henselae is a membrane protein consisting of 137 amino acids that plays a crucial role in osmotic regulation. This protein is significant for research because mechanosensitive channels function as emergency release valves during osmotic stress, allowing bacteria to survive environmental changes during host infection. Understanding MscL structure and function provides insights into B. henselae's adaptation mechanisms during pathogenesis.

How does B. henselae MscL compare to mechanosensitive channels in other bacterial species?

While the core channel architecture is conserved, variations in amino acid sequences between species can affect gating tension thresholds, ion selectivity, and interactions with other membrane components. These differences may represent evolutionary adaptations to the specific osmotic challenges faced by B. henselae during its infection cycle. Particularly noteworthy is how B. henselae must adapt to different osmotic environments during transitions between the mammalian bloodstream and cell cytoplasm, as well as during transmission via insect vectors.

What are the optimal conditions for expressing recombinant B. henselae MscL protein?

For efficient expression of recombinant B. henselae MscL protein, E. coli is the preferred heterologous expression system . The following methodological approach is recommended:

  • Vector selection: pET-based expression vectors containing an N-terminal His-tag are commonly used for overexpression of membrane proteins.

  • E. coli strain optimization: BL21(DE3), C41(DE3), or C43(DE3) strains are effective for membrane protein expression, with the latter two being specially designed for potentially toxic membrane proteins.

  • Growth conditions:

    • Initial culture growth at 37°C until OD600 reaches 0.6-0.8

    • Temperature reduction to 18-25°C prior to induction

    • IPTG concentration between 0.1-0.5 mM for induction

    • Extended expression period (16-20 hours) at reduced temperature

  • Media optimization:

    • Terrific Broth or 2xYT media supplemented with glucose (0.2-0.5%)

    • Addition of osmotic stabilizers like glycerol (5-10%)

  • Scale-up considerations: Expression in fermenters with controlled oxygen supply can significantly increase yield for large-scale production.

This systematic approach addresses the challenges associated with membrane protein expression, including potential toxicity, improper folding, and inclusion body formation.

What purification strategies yield the highest quality B. henselae MscL preparations?

A multi-step purification process is essential for obtaining high-quality, functional B. henselae MscL protein:

  • Membrane extraction:

    • Cell disruption via sonication or high-pressure homogenization

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using appropriate detergents (n-Dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or LDAO)

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Gradient elution with imidazole (20-500 mM)

    • Supplementation of all buffers with selected detergent at concentrations above critical micelle concentration

  • Size exclusion chromatography:

    • Further purification and assessment of oligomeric state

    • Buffer exchange to remove imidazole

    • Confirmation of pentameric assembly typical for MscL proteins

  • Quality assessment checkpoints:

    • SDS-PAGE analysis at each purification stage

    • Western blot verification

    • Dynamic light scattering to assess homogeneity

    • Circular dichroism to confirm secondary structure integrity

The final purified protein should be maintained in a stabilizing buffer containing detergent above its critical micelle concentration, with 5-50% glycerol added for long-term storage at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

What electrophysiological methods are most effective for studying B. henselae MscL activity?

Electrophysiological characterization of B. henselae MscL requires specialized techniques that capture its mechanosensitive properties:

  • Patch-clamp in artificial liposomes:

    • Reconstitution of purified MscL into liposomes with controlled lipid composition

    • Gigaohm seal formation on liposome patches

    • Application of negative pressure to induce channel opening

    • Single-channel conductance and subconductance states measurement

    • Analysis of gating kinetics under varying membrane tensions

  • Planar lipid bilayer recordings:

    • Formation of stable bilayers with incorporated MscL proteins

    • Use of pressure application systems to precisely control membrane tension

    • Advantage of higher throughput compared to patch-clamp

  • Fluorescence-based flux assays:

    • Incorporation of MscL into liposomes loaded with fluorescent dyes

    • Measurement of dye release upon hypoosmotic shock

    • Quantification of channel activity in bulk samples

    • Compatibility with high-throughput screening approaches

  • Data analysis considerations:

    • Threshold tension calculation for channel activation

    • Conductance-voltage relationships

    • Open probability as a function of membrane tension

    • Kinetic modeling of channel gating

These methods provide complementary insights into MscL function, with patch-clamp offering detailed single-channel analysis and fluorescence assays enabling higher throughput screening of channel modulators.

How can researchers investigate the role of B. henselae MscL during host cell infection?

Investigating MscL's role during B. henselae infection requires approaches that bridge molecular mechanisms with pathogenesis:

  • Generation of mscL knockout and complemented strains:

    • Site-directed mutagenesis to create non-functional variants

    • Complementation with wild-type and mutant alleles

    • Controlled expression systems for titration of MscL levels

  • Infection models utilizing various cell types:

    • Human umbilical vein endothelial cells (HUVECs) - known targets for B. henselae

    • Mesenchymal stromal cells (MSCs) - potential bacterial reservoirs

    • Comparative infection efficiency assays between wild-type and mscL-deficient strains

  • Osmotic challenge during infection:

    • Exposing infected cells to controlled osmotic shifts

    • Measuring bacterial survival and replication rates

    • Assessing host cell responses to osmotically stressed bacteria

  • Intracellular localization studies:

    • Immunofluorescence microscopy to track MscL during infection

    • Colocalization with markers of specific cellular compartments

    • Analysis of MscL distribution in perinuclear membrane-bound vacuoles, where B. henselae typically resides

  • Host-pathogen transcriptomics:

    • RNA-seq analysis comparing host responses to wild-type versus mscL-deficient bacteria

    • Identification of differentially regulated pathways

Research has shown that B. henselae can persist within MSCs in perinuclearly bound vacuoles for up to 8 days . Investigating how MscL contributes to this persistence would provide valuable insights into pathogenesis mechanisms.

How can site-directed mutagenesis of B. henselae MscL advance understanding of channel gating mechanisms?

Site-directed mutagenesis provides powerful insights into structure-function relationships of MscL channels:

  • Strategic mutation target selection:

    • Transmembrane domains (TM1, TM2) containing the hydrophobic gate

    • Periplasmic loops involved in tension sensing

    • Cytoplasmic helices that influence channel kinetics

    • Conserved glycine residues at helix-helix interfaces

  • Functional consequences assessment:

    • Gain-of-function mutations that lower activation threshold

    • Loss-of-function mutations that increase activation threshold

    • Alterations in channel conductance or ion selectivity

    • Changes in adaptation/desensitization kinetics

  • Experimental validation pipeline:

    • In vitro characterization using electrophysiology and spectroscopy

    • In vivo osmotic shock survival assays

    • Structural studies to confirm predicted conformational changes

    • Molecular dynamics simulations to interpret experimental findings

  • Systematic mutation series approaches:

    • Alanine scanning of entire protein domains

    • Charge substitutions to probe electrostatic interactions

    • Hydrophobicity alterations at the channel gate

    • Introduction of disulfide bridges to restrict conformational changes

This systematic mutagenesis approach can elucidate the molecular determinants of MscL function and potentially identify residues unique to B. henselae that might be involved in its specific adaptation to host environments during infection.

What is the potential of B. henselae MscL as a target for novel antimicrobial development?

The mechanosensitive channel MscL represents a promising antimicrobial target due to several favorable characteristics:

  • Unique gating mechanism susceptible to manipulation:

    • Compounds that trigger premature channel opening can cause metabolite leakage

    • Molecules that prevent channel opening during osmotic shock induce bacterial lysis

    • Peptides that interact with the channel's hydrophobic gate

  • Drug discovery methodologies:

    • High-throughput screening of compound libraries using fluorescence-based assays

    • Structure-based design targeting specific protein domains

    • Fragment-based approaches identifying initial binding molecules

    • Repositioning of known ion channel modulators from other research areas

  • Advantage in the context of B. henselae infections:

    • Essential role during osmotic adaptation when transitioning between environments

    • Potential importance during intracellular survival in perinuclear vacuoles

    • Possible involvement in antibiotic tolerance mechanisms

  • Evaluation metrics for candidate compounds:

    • Specificity for bacterial versus mammalian mechanosensitive channels

    • Efficacy in cell culture infection models

    • Compatibility with existing antibiotics for combination therapy

    • Pharmacokinetic properties suitable for reaching intracellular bacteria

  • Rational design considerations:

    • Targeting regions with low sequence homology to human proteins

    • Exploiting differences in membrane lipid composition between bacteria and mammalian cells

    • Developing prodrugs activated in bacterial microenvironments

Given that B. henselae can persist intracellularly and may contribute to ineffective erythropoiesis, targeting MscL could provide novel therapeutic options for persistent or recalcitrant infections .

What are the common challenges in working with recombinant B. henselae MscL and how can they be addressed?

Working with recombinant membrane proteins like B. henselae MscL presents several technical challenges that require specific troubleshooting approaches:

  • Low expression yields:

    • Challenge: Membrane protein overexpression often results in toxicity and poor yields

    • Solutions:

      • Use specialized E. coli strains (C41/C43)

      • Employ tunable expression systems with lower induction levels

      • Optimize growth temperature and media composition

      • Consider fusion partners that enhance folding and expression

  • Protein misfolding and aggregation:

    • Challenge: Membrane proteins tend to form inclusion bodies when overexpressed

    • Solutions:

      • Reduce expression temperature to 16-20°C

      • Add chemical chaperones to growth media

      • Optimize detergent type and concentration during solubilization

      • Consider refolding protocols if inclusion bodies are unavoidable

  • Detergent selection complications:

    • Challenge: Different detergents affect protein stability and activity differently

    • Solutions:

      • Screen multiple detergent classes (maltoside, glucoside, fos-choline)

      • Perform stability assays with each detergent

      • Consider detergent exchange during purification

      • Evaluate amphipols or nanodiscs for improved stability

  • Functional assessment difficulties:

    • Challenge: Measuring mechanosensitive channel activity requires specialized equipment

    • Solutions:

      • Develop surrogate assays for initial screening

      • Collaborate with electrophysiology specialists

      • Utilize fluorescence-based liposome assays as alternatives

      • Consider in vivo complementation assays in E. coli

  • Storage stability issues:

    • Challenge: Purified membrane proteins often lose activity during storage

    • Solutions:

      • Optimize buffer composition with stabilizing agents

      • Add glycerol (5-50%) to prevent freeze-induced denaturation

      • Store as aliquots to avoid freeze-thaw cycles

      • Consider lyophilization with appropriate excipients

Maintaining proper reconstitution procedures is crucial, as incorrect reconstitution can lead to irreversible protein aggregation. The manufacturer recommends reconstituting in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How should researchers interpret contradictory data when studying B. henselae MscL function in different experimental systems?

When facing contradictory results across experimental systems, a systematic analytical approach is essential:

  • Experimental system discrepancy analysis:

    • Differences between in vitro reconstituted systems versus in vivo bacterial studies

    • Variations in lipid composition affecting channel properties

    • Differences between heterologous expression systems and native bacterial expression

    • Potential effects of fusion tags on protein function

  • Methodological validation steps:

    • Cross-validation using multiple independent techniques

    • Positive and negative controls specific to each experimental system

    • Calibration assays to normalize data across platforms

    • Careful examination of experimental parameters (temperature, pH, ionic strength)

  • Data reconciliation strategies:

    • Development of unifying models that explain apparent contradictions

    • Identification of context-dependent factors influencing channel behavior

    • Statistical meta-analysis of multiple datasets

    • Consideration of post-translational modifications or protein interactions

  • Biological context integration:

    • Relating findings to B. henselae's lifecycle and infection strategy

    • Considering the bacterial microenvironment during host infection

    • Evaluating potential regulation mechanisms that could explain different functional states

  • Collaborative approach recommendations:

    • Standardization of protocols across research groups

    • Multi-laboratory validation studies

    • Development of consensus guidelines for MscL functional assays

    • Integration of computational modeling with experimental data

Understanding contradictions often leads to important discoveries about regulatory mechanisms or context-dependent protein functions that may be relevant to B. henselae's adaptation during its complex infection cycle.

What emerging technologies hold promise for advancing B. henselae MscL research?

Several cutting-edge technologies are poised to transform our understanding of B. henselae MscL structure and function:

  • Cryo-electron microscopy advances:

    • Single-particle analysis for high-resolution structures in different conformational states

    • Time-resolved cryo-EM to capture intermediate states during gating

    • Visualization of MscL within native membrane environments

  • Advanced functional imaging techniques:

    • Super-resolution microscopy to track MscL distribution during infection

    • FRET-based tension sensors to monitor channel activation in situ

    • Single-molecule tracking to analyze dynamics in living cells

  • Innovative membrane mimetic systems:

    • Nanodiscs with controlled lipid composition for functional studies

    • Droplet interface bilayers for high-throughput electrophysiology

    • Microfluidic platforms for precise control of mechanical forces

  • Genome editing tools for bacterial studies:

    • CRISPR-Cas systems adapted for precise genomic modification in Bartonella

    • Development of inducible gene expression systems for temporal control

    • Site-specific recombination strategies for in vivo structure-function studies

  • Computational approaches:

    • Enhanced molecular dynamics simulations spanning biologically relevant timescales

    • Machine learning algorithms for predicting channel-compound interactions

    • Multiscale modeling connecting molecular events to cellular phenotypes

These technologies will help address fundamental questions about how B. henselae MscL contributes to bacterial survival during host adaptation and may lead to novel therapeutic strategies targeting this important membrane protein.

How might B. henselae MscL research contribute to understanding bacterial persistence in host tissues?

Research on B. henselae MscL has significant implications for understanding bacterial persistence:

  • Connection to intracellular survival mechanisms:

    • MscL function during adaptation to intracellular osmotic environments

    • Potential role in maintaining bacterial integrity within perinuclear vacuoles observed in MSCs

    • Contribution to bacterial responses to host defense mechanisms

  • Osmotic adaptation during host-cell transitions:

    • MscL activity when bacteria move between bloodstream and intracellular environments

    • Role during invasion of various cell types with different osmotic profiles

    • Adaptation mechanisms during transition from cat reservoir to human host

  • Integration with broader stress response networks:

    • Interplay between osmotic stress responses and other adaptation mechanisms

    • Relationship between MscL function and expression of virulence factors

    • Connections to metabolic adaptations during persistent infection

  • Research model development:

    • Advanced cell culture models mimicking the MSC infection niche

    • Animal models of persistent Bartonella infection

    • Microfluidic organ-on-chip approaches for studying host-pathogen interactions

  • Translational implications:

    • Insights into fundamental mechanisms of bacterial persistence

    • Identification of potential targets for eliminating persistent infections

    • Development of biomarkers for monitoring treatment efficacy

Studies have shown that B. henselae can persist within MSCs for extended periods, with bacteria localizing in perinuclearly bound vacuoles . Understanding how MscL contributes to osmotic adaptation in this specific niche could provide crucial insights into the molecular mechanisms of bacterial persistence and inform the development of new therapeutic strategies for persistent infections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.