Recombinant Bartonella henselae NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in B. henselae

As part of the NADH-quinone oxidoreductase complex, nuoK facilitates electron transfer from NADH to quinones, contributing to:

While direct functional studies on B. henselae nuoK are scarce, its homology to other bacterial NADH dehydrogenase subunits suggests conserved catalytic mechanisms .

Production and Purification

Recombinant nuoK is produced via prokaryotic expression systems:

ParameterDetail
Expression HostE. coli
TagN-terminal histidine tag
PurificationNickel-agarose chromatography
Yield~2.9 mg per 100 mL bacterial culture (analogous to B. henselae 17-kDa protein)

Pathogenicity Studies

Investigating nuoK could elucidate B. henselae’s energy metabolism and persistence in host cells, aiding in vaccine/drug development.

Comparative Analysis with B. quintana nuoK

Subunit K from B. quintana (UniProt Q6FZY1) shares structural similarities but differs in sequence:

FeatureB. henselae nuoK (Q6G398)B. quintana nuoK (Q6FZY1)
AA SequenceMHIDIMHYLIVSALMF...MHIDITHYLIVSALIFTI...
Expression SystemE. coliE. coli
Purity>90%>90%

Clinical and Diagnostic Potential

While B. henselae detection primarily relies on PCR and immunofluorescence assays , recombinant proteins like nuoK could enhance serological testing specificity. For example:

  • ELISA Development: Similar to Campylobacter hominis nuoK ELISA kits , B. henselae nuoK might improve antibody detection.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; BH08850; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
nuoK
Target Protein Sequence
MHIDIMHYLIVSALMFTIGIAGIFLNRKNVIIILMSIELILLSVNLNFVAFSAFLHDLVG QVFALFILTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links

KEGG: bhe:BH08850

STRING: 283166.BH08850

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Bartonella henselae NADH-quinone oxidoreductase subunit K?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of Complex I in the electron transport chain of Bartonella henselae. This membrane-bound subunit contributes to energy metabolism in this gram-negative bacterium. Structurally, nuoK typically contains multiple transmembrane helices that anchor it within the bacterial membrane. The protein functions as part of the proton-translocating mechanism, helping to establish the proton gradient necessary for ATP synthesis. When studying this protein, researchers should employ hydrophobic interaction chromatography or similar techniques suitable for membrane proteins. For functional studies, measuring proton translocation using pH-sensitive fluorescent dyes combined with oxygen consumption assays can provide insights into the protein's role in bacterial energy metabolism.

How is Recombinant B. henselae nuoK expressed and purified for research purposes?

Expression of Recombinant B. henselae nuoK typically employs prokaryotic systems such as E. coli or eukaryotic systems including yeast, baculovirus, or mammalian cells . The methodological approach involves:

  • Gene synthesis or amplification from B. henselae genomic DNA using specific primers

  • Cloning into an appropriate expression vector with a fusion tag (His, GST, etc.)

  • Transformation into the expression host

  • Induction of protein expression (IPTG for E. coli systems)

  • Cell lysis under conditions that maintain membrane protein integrity

  • Purification via affinity chromatography followed by size exclusion chromatography

For membrane proteins like nuoK, detergent solubilization is critical. Common detergents include n-dodecyl-β-D-maltoside (DDM) or digitonin. Purification typically yields >90% pure protein suitable for enzymatic and structural studies . Storage as a liquid containing glycerol at -20°C or -80°C maintains protein integrity, with working aliquots kept at 4°C for up to one week .

What methods are effective for verifying the identity and purity of Recombinant B. henselae nuoK?

Multiple complementary techniques should be employed to verify protein identity and purity:

TechniquePurposeExpected Results
SDS-PAGEPurity assessmentSingle band at expected molecular weight
Western blotIdentity confirmationSpecific binding with anti-nuoK or anti-tag antibodies
Mass spectrometryAccurate mass and sequence verificationPeptide matches to nuoK sequence
N-terminal sequencingConfirmation of intact N-terminusMatches to predicted sequence
Dynamic light scatteringHomogeneity assessmentSingle peak indicating monodispersity

For Western blot analysis, methodology similar to that used for other Bartonella proteins can be employed, where electrophoretically separated proteins are transferred to nitrocellulose membranes, blocked with appropriate buffer (e.g., 8% whole milk, 50 mM Tris, 250 mM NaCl, 0.2% Tween), and probed with specific antibodies . This multi-technique approach ensures both the identity and quality of the recombinant protein before proceeding with functional or structural studies.

How does B. henselae nuoK compare to homologous proteins in other bacterial species?

Comparative analysis of B. henselae nuoK with homologous proteins requires a systematic bioinformatics approach:

  • Multiple sequence alignment using CLUSTAL Omega or similar tools to identify conserved regions

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural homology modeling based on crystallized bacterial Complex I components

The nuoK protein in B. henselae shares conserved features with other bacterial NADH-quinone oxidoreductases, particularly in transmembrane domains and residues involved in proton translocation. Targeted comparisons should include related pathogens like Bartonella quintana, which has genomic similarities to B. henselae as evidenced in comparative studies . Experimental validation of predicted structural or functional similarities can be performed through complementation studies in nuoK knockout strains or through chimeric protein construction between species. This comparative approach provides insights into both conserved mechanisms and species-specific adaptations in respiratory chain components.

What role might nuoK play in B. henselae pathogenesis and host cell interactions?

The role of nuoK in B. henselae pathogenesis remains an emerging area of research. Methodological approaches to investigate this question include:

  • Generation of nuoK deletion mutants using CRISPR-Cas9 or homologous recombination techniques

  • Comparative virulence studies between wild-type and mutant strains in cellular infection models

  • Transcriptomic analysis of nuoK expression under different conditions mimicking host environments

  • Metabolomic profiling to assess changes in bacterial metabolism during host cell invasion

Given that B. henselae is an intracellular pathogen with preference for red blood cells, macrophages, and endothelial cells , energy metabolism adaptations mediated by respiratory chain components like nuoK may be critical for survival within these diverse cellular environments. The bacterium causes approximately 20,000 cases of "Cat scratch disease" annually in the United States , suggesting potential roles for metabolic adaptation proteins in establishing persistent infection. Research should focus on how nuoK-mediated energy production might be modulated during different stages of infection, particularly during transition between vectors (fleas) and mammalian hosts.

What are the challenges and solutions in developing enzymatic assays for Recombinant B. henselae nuoK activity?

Developing robust enzymatic assays for membrane-bound respiratory chain components presents several challenges:

ChallengeMethodological Solution
Maintaining native conformationReconstitution into proteoliposomes or nanodiscs
Coupling with other Complex I componentsCo-expression with interacting subunits
Measuring proton translocationpH-sensitive fluorescent probes (ACMA, pyranine)
Differentiating from host cell activitiesSpecific inhibitors and bacterial-specific electron donors
Automation for drug screeningAdaptation to microplate format with appropriate controls

A comprehensive activity assay should measure both electron transfer (using NADH oxidation rates) and proton translocation simultaneously. Researchers should employ stopped-flow spectroscopy to capture rapid kinetics of electron transfer. For inhibitor studies, comparing activity in the presence of known Complex I inhibitors (rotenone, piericidin A) provides important controls. When studying potential antimicrobial compounds targeting nuoK, establishing structure-activity relationships requires careful enzyme kinetic analysis under varying substrate and inhibitor concentrations, with data analysis using appropriate enzyme inhibition models.

How can structural studies of Recombinant B. henselae nuoK inform drug discovery efforts?

Structural characterization of B. henselae nuoK represents a valuable approach for targeted drug development:

  • Cryo-electron microscopy of reconstituted Complex I containing nuoK

  • X-ray crystallography of nuoK alone or in complex with other subunits

  • NMR studies of specific domains, particularly those exposed to potential drug binding

  • Molecular dynamics simulations to identify conformational changes during catalysis

The methodology should focus on identifying unique structural features of B. henselae nuoK compared to human mitochondrial homologs. This selectivity analysis is crucial for developing antimicrobials with minimal host toxicity. Structure-based virtual screening can then be employed to identify small molecules that bind specifically to bacterial nuoK. Hit compounds should be validated using thermal shift assays and enzyme inhibition studies. Since B. henselae has shown preference for red blood cells, macrophages, and endothelial cells , targeting nuoK might disrupt the bacterium's energy metabolism specifically within these cellular niches, potentially providing novel treatment options for bartonellosis.

How does post-translational modification affect the function of B. henselae nuoK?

Investigation of post-translational modifications (PTMs) in bacterial respiratory chain components requires sophisticated analytical approaches:

  • Mass spectrometry-based proteomics targeting specific modifications

  • Site-directed mutagenesis of potential modification sites

  • Activity assays comparing modified and unmodified forms of the protein

  • Expression of nuoK under different growth conditions to induce various PTMs

Common bacterial PTMs that might affect nuoK include phosphorylation, acetylation, and lipidation. Each modification potentially serves as a regulatory mechanism adapting respiratory chain function to changing environmental conditions. The methodology should include expressing recombinant nuoK in systems that preserve native bacterial PTMs (such as closely related bacterial expression hosts) rather than artificial systems that might introduce non-native modifications. Functional studies comparing enzyme kinetics between differentially modified forms provide insights into how B. henselae might regulate energy metabolism during infection or environmental stress responses.

What approaches are most effective for studying nuoK-protein interactions within the B. henselae respiratory complex?

Understanding protein-protein interactions involving nuoK requires multiple complementary techniques:

TechniqueApplicationAdvantages
Bacterial two-hybridInitial interaction screeningIn vivo detection
Co-immunoprecipitationVerification of physical associationCaptures native complexes
Surface plasmon resonanceBinding kineticsReal-time measurements
Crosslinking mass spectrometryInterface identificationMaps interaction surfaces
FRET/BRET assaysDynamic interactionsMonitors in live cells

How can genetic manipulation of nuoK inform our understanding of B. henselae metabolism and pathogenesis?

Genetic manipulation of nuoK provides powerful insights into its biological significance:

  • CRISPR-Cas9 or homologous recombination for precise gene editing

  • Conditional expression systems to control nuoK levels

  • Domain swapping with homologs from other species

  • Site-directed mutagenesis of catalytic or structural residues

Experimental approaches should include:

  • Growth kinetics under various carbon sources and oxygen tensions

  • Mammalian cell invasion and persistence assays

  • Metabolic flux analysis using stable isotope labeling

  • In vivo infection models in appropriate animal systems

What diagnostic potential does Recombinant B. henselae nuoK hold for detecting bartonellosis?

Evaluating the diagnostic utility of Recombinant B. henselae nuoK requires systematic serological testing:

  • Development of ELISA assays using purified recombinant nuoK

  • Western blot analysis to verify specific antibody binding

  • Comparison with established diagnostic antigens like Pap31

The methodology should follow approaches similar to those used for evaluating other B. henselae antigens, such as the recombinant Pap31 protein, which has been tested for diagnostic potential with sensitivity and specificity assessments using sera from infected and control groups . Researchers should establish appropriate cutoff values determined at maximum Youden index values, and perform receiver operating characteristic (ROC) analysis to determine area under the curve (AUC) scores . Testing should include samples from both immunocompetent and immunocompromised patients, as B. henselae can cause different manifestations in these populations . The diagnostic performance should be compared with existing methods such as immunofluorescence assays (IFA) and PCR of tissue samples, as was recently demonstrated in case studies examining brain tissue from patients with suspected bartonellosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.