Recombinant Bartonella henselae Putative zinc metalloprotease BH06270 (BH06270)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
BH06270; Putative zinc metalloprotease BH06270
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
BH06270
Target Protein Sequence
MIIIFVHEAGHYLIGRWCGIKASVFSLGFGPQIVGYTDKRGTQWRLALIPLGGYVKFIGD EEGLHGTSSQSLPIVDGSFGSAHAWKKAATVFAGPLFNVLFTVVILTFFFFTYGRVAIEP VVGSFVKDSPAVQAGLQLGDRFIEMDGQQVESFEDLMNYVTFHGGDPIEFKMERSGQVFT TVITPKVVERDDGFGNRVRSGLMGVGVPVDPDNPARLDPAYVKHIRYSFGRALREASKRA TFIVTQTVFFMGRLLGGKEDHCRLSGPSKTVKIAWQVSETGFLSLLNFTAFLSIGVGLIN LFPIPPLDGGYLLFHVVEIITGRPISAKIREIIFRLGLCFVLLFMFFALFNDYFCWFS
Uniprot No.

Target Background

Database Links

KEGG: bhe:BH06270

STRING: 283166.BH06270

Protein Families
Peptidase M50B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bartonella henselae Putative zinc metalloprotease BH06270?

Bartonella henselae Putative zinc metalloprotease BH06270 is a full-length protein (358 amino acids) encoded by the BH06270 gene in Bartonella henselae. It belongs to the zinc metalloprotease family, a group of enzymes that utilize zinc ions in their catalytic activity to cleave peptide bonds. The protein has been assigned the UniProt ID Q8VQ25 and can be produced as a recombinant protein with an N-terminal His-tag using E. coli expression systems. The recombinant form allows for purification and detailed functional studies of this putative enzyme .

How should recombinant BH06270 protein be stored and handled for optimal stability?

For optimal stability and retention of biological activity, the recombinant BH06270 protein should be stored at -20°C/-80°C upon receipt. The lyophilized powder form provides extended shelf-life, but once reconstituted, working aliquots should be stored at 4°C for no longer than one week. Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided; therefore, preparing multiple small aliquots is recommended.

When reconstituting the protein, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. Adding glycerol to a final concentration of 5-50% (with 50% being optimal) provides cryoprotection for long-term storage. Prior to opening the vial, brief centrifugation is recommended to bring contents to the bottom. The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution .

How should I design experiments to characterize the enzymatic activity of BH06270 protein?

Designing experiments to characterize the enzymatic activity of BH06270 requires a systematic approach based on its putative function as a zinc metalloprotease:

  • Substrate Screening: Begin with a panel of known metalloprotease substrates, including fluorogenic peptides, to identify those cleaved by BH06270. Include matrix proteins, peptide hormones, and cytokines as potential physiological substrates.

  • Enzymatic Assay Development: Establish optimal conditions for activity including:

    • pH range (typically 7.0-8.5 for metalloproteases)

    • Temperature (25-37°C)

    • Divalent metal ion requirements (ZnCl₂, CaCl₂, MgCl₂)

    • Buffer composition (avoiding EDTA or other metal chelators)

  • Kinetic Parameters Determination: Measure Km, Vmax, and kcat values using varying substrate concentrations under optimal conditions.

  • Inhibitor Studies: Test specific metalloprotease inhibitors (e.g., TIMP family proteins, hydroxamates, or chelating agents) to confirm the metalloprotease classification and identify specific inhibition patterns.

  • Site-Directed Mutagenesis: Modify predicted catalytic residues to confirm their role in enzymatic activity.

This experimental design should include appropriate positive controls (known metalloproteases) and negative controls (heat-inactivated enzyme), with all experiments performed in at least triplicate to ensure reproducibility and statistical significance .

What experimental controls should be included when studying BH06270 in the context of host-pathogen interactions?

Essential Experimental Controls:

  • Uninfected Host Cell Controls: Cells without any Bartonella henselae infection to establish baseline expression and activity levels of host proteins.

  • Specific Protein Controls:

    • Wild-type B. henselae strain (expressing BH06270)

    • BH06270 knockout strain (gene deletion mutant)

    • Complemented BH06270 strain (genetic restoration of function)

    • Catalytically inactive BH06270 mutant (for distinguishing enzymatic vs. structural roles)

  • Expression Level Controls:

    • Dosage-dependent experiments with varying MOI (multiplicity of infection)

    • Time-course studies to track temporal effects

    • qRT-PCR validation of BH06270 expression levels during infection

  • Cross-Species Controls: Comparison with homologous proteins from related Bartonella species or other pathogens to identify species-specific vs. conserved functions.

  • Host Factor Controls: Experiments in cells with knockdown/knockout of putative host targets or interacting proteins.

This controlled experimental design allows for proper attribution of phenotypic changes to BH06270 activity while minimizing confounding variables that might affect interpretation of host-pathogen interaction studies .

How can I design RNA interference experiments to study the function of BH06270 in tick-Bartonella interactions?

Designing effective RNA interference (RNAi) experiments to study BH06270 function in tick-Bartonella interactions requires careful planning:

RNAi Experimental Design Protocol:

  • siRNA/dsRNA Design:

    • Target unique regions of BH06270 mRNA (avoid conserved domains shared with other metalloproteases)

    • Design 3-4 different siRNAs targeting different regions of the transcript

    • Include appropriate non-targeting control siRNAs

    • Validate sequence specificity using BLAST against tick and Bartonella genomes

  • Delivery Method Selection:

    • Microinjection directly into tick hemocoel (most effective but technically challenging)

    • Immersion technique for nymphs or larvae

    • Artificial membrane feeding with siRNA in blood meal

    • Capillary feeding technique for unfed ticks

  • Validation of Knockdown:

    • qRT-PCR to measure BH06270 transcript reduction (target >70% reduction)

    • Western blot to confirm protein reduction

    • Assess for off-target effects on related genes

  • Experimental Timeline:

    • Introduce RNAi before Bartonella infection

    • Allow sufficient time for protein turnover (typically 24-48 hours)

    • Monitor knockdown persistence throughout the experimental period

  • Phenotypic Assessment:

    • Tick feeding success metrics (attachment duration, blood meal volume, molting success)

    • Bartonella colonization levels in tick tissues (quantitative PCR)

    • Transmission efficiency to naive hosts

This methodological approach will help determine how BH06270 contributes to Bartonella acquisition, maintenance, or transmission by ticks, while controlling for experimental variables that might confound interpretation .

How should differential expression data of BH06270 be analyzed in comparative studies?

Analysis of differential expression data for BH06270 in comparative studies requires a systematic analytical framework:

Differential Expression Analysis Protocol:

  • Data Normalization:

    • Apply appropriate normalization methods (e.g., RPKM, TPM, or DESeq2 normalization) to account for sequencing depth and gene length

    • Use multiple housekeeping genes for qRT-PCR normalization rather than a single reference gene

    • Consider tissue-specific normalization factors when comparing across different sample types

  • Statistical Analysis:

    • Calculate fold change (FC) between experimental conditions

    • Implement appropriate statistical tests (t-test for paired comparisons or ANOVA for multiple conditions)

    • Apply false discovery rate (FDR) correction for multiple testing

    • Set significance thresholds (p≤0.05 and |log₂FC|≥1.0 are typical)

  • Visualization Approaches:

    • Generate volcano plots highlighting BH06270 expression changes

    • Create heatmaps to visualize BH06270 expression across multiple conditions

    • Use time-course expression curves for temporal studies

  • Contextual Analysis:

    • Compare BH06270 expression patterns with functionally related genes

    • Perform pathway enrichment analysis to identify biological processes affected

    • Examine co-expression networks to identify potential functional relationships

  • Validation Strategy:

    • Confirm RNA-seq findings with qRT-PCR on independent biological replicates

    • Validate at protein level using western blot or proteomics approaches

    • Correlate expression changes with functional outcomes

This analytical approach provides a comprehensive framework for interpreting BH06270 expression data within the broader context of host-pathogen interactions, particularly in tick-Bartonella systems .

How do I interpret contradictory findings regarding BH06270 function across different experimental systems?

When encountering contradictory findings regarding BH06270 function across experimental systems, a structured analytical approach can help resolve discrepancies:

Framework for Resolving Contradictory Findings:

  • Systematic Comparison of Experimental Conditions:

    • Create a comprehensive table comparing key parameters across studies:

    ParameterStudy AStudy BStudy CPotential Impact
    Protein constructFull-lengthTruncatedDomain-specificAffects enzyme activity and substrate specificity
    Expression systemE. coliInsect cellsMammalian cellsPost-translational modifications differ
    Purification methodAffinitySize exclusionIon exchangeMay affect protein folding and activity
    Assay conditionspH 7.0, 25°CpH 8.0, 37°CpH 6.5, 30°CEnzymatic optima vary with conditions
    Host cell typesTick cellsMammalian cellsIn vivo modelCell-specific cofactors or substrates
    Infection modelArtificial feedingDirect injectionNatural infectionRoute affects pathogen-host interaction
  • Biological vs. Technical Variability Assessment:

    • Determine if contradictions arise from biological diversity (strain differences, host specificity) or technical limitations (assay sensitivity, experimental design)

    • Evaluate statistical power and sample sizes across studies

    • Assess biological replicates vs. technical replicates

  • Hierarchical Evaluation of Evidence:

    • Prioritize in vivo findings over in vitro results

    • Consider evolutionary conservation of functions across species

    • Give more weight to studies with robust controls and validation experiments

  • Integrative Analysis:

    • Develop testable hypotheses that could reconcile contradictory findings

    • Design experiments specifically addressing the contradictions

    • Consider context-dependent functions of BH06270 in different environments

This structured approach helps differentiate genuine biological complexity from experimental artifacts, leading to a more nuanced understanding of BH06270 function that accommodates apparently contradictory results .

How can structural prediction of BH06270 guide inhibitor development for therapeutic applications?

Utilizing structural prediction to guide inhibitor development for BH06270 requires a progressive approach from computational modeling to experimental validation:

Structure-Based Inhibitor Development Workflow:

  • Computational Structure Prediction:

    • Perform homology modeling using crystal structures of related zinc metalloproteases as templates

    • Implement threading approaches for regions with low sequence similarity

    • Refine models using molecular dynamics simulations

    • Validate model quality using Ramachandran plots, QMEAN, and ProSA scores

  • Active Site and Substrate Binding Pocket Analysis:

    • Identify the catalytic zinc-binding motif (typically HEXXH)

    • Characterize substrate-binding pocket dimensions and electrostatic properties

    • Identify conserved residues across Bartonella species vs. host-specific variations

    • Map surface accessibility of potential binding sites

  • Virtual Screening and Inhibitor Design:

    • Perform molecular docking with diverse compound libraries

    • Design peptidomimetic inhibitors based on substrate cleavage sites

    • Implement fragment-based design targeting specific sub-pockets

    • Optimize lead compounds for specificity against BH06270 vs. host metalloproteases

  • In Vitro Validation:

    • Synthesize top computational hits for biochemical testing

    • Determine inhibition constants (Ki) and mechanism of inhibition

    • Perform structure-activity relationship (SAR) studies

    • Assess selectivity profiles against related metalloproteases

  • Therapeutic Potential Assessment:

    • Evaluate cellular toxicity of lead inhibitors

    • Test efficacy in cellular infection models

    • Assess pharmacokinetic properties and bioavailability

    • Determine efficacy in relevant animal models of Bartonella infection

This integrated computational-experimental approach enables rational design of selective inhibitors against BH06270, potentially leading to novel therapeutic strategies for Bartonella infections while minimizing off-target effects on host metalloproteases .

What role might BH06270 play in tick-borne transmission of Bartonella henselae?

The potential role of BH06270 in tick-borne transmission of Bartonella henselae can be analyzed through examination of its expression patterns and functional implications:

Evidence for BH06270 Role in Tick Transmission:

  • Differential Expression Patterns:

    • Zinc-dependent metalloproteases show altered expression in tick salivary glands in response to B. henselae infection

    • The expression of zinc-dependent metalloproteases appears to be regulated during B. henselae infection, with 2 transcripts being up-regulated as revealed by transcriptomic analysis

    • This differential regulation suggests a specific role during the tick-pathogen interaction phase

  • Potential Functional Mechanisms:

    • Immune Evasion: BH06270 may cleave host immune recognition molecules, facilitating establishment of infection

    • Tissue Invasion: Degradation of extracellular matrix components could enable pathogen dissemination

    • Blood Meal Processing: May interact with tick digestive enzymes to create a favorable environment for Bartonella

    • Biofilm Formation: Potential role in processing surface proteins required for bacterial aggregation

  • Comparative Analysis with Other Tick-Borne Pathogens:

    • Several tick-borne pathogens utilize metalloproteases for transmission and establishment

    • Host-pathogen protein interaction networks often target similar host defense mechanisms

  • Experimental Evidence from Related Systems:

    • BIr (B. henselae-infected I. ricinus) ticks show altered gene expression profiles in salivary glands

    • BPTI/Kunitz family protease inhibitors show differential regulation during infection, suggesting protease-inhibitor balance is important during transmission

Understanding BH06270's role requires integration of transcriptomic data with functional studies, potentially using RNAi knockdown in ticks to assess effects on acquisition, maintenance, and transmission of B. henselae. The demonstrated regulation of zinc-dependent metalloproteases during infection supports a functional role in the tick-Bartonella interface, though more direct evidence is needed to fully characterize its specific contributions .

How can comparative genomics be used to identify conserved functional domains in BH06270 across Bartonella species?

Comparative genomics provides powerful approaches to identify conserved functional domains in BH06270 across Bartonella species, offering insights into evolutionary pressures and essential functions:

Comparative Genomics Methodology:

  • Sequence Collection and Alignment:

    • Retrieve BH06270 homologs from all sequenced Bartonella species

    • Include related genes from closely related α-proteobacteria as outgroups

    • Generate multiple sequence alignments using MUSCLE, MAFFT, or T-Coffee

    • Refine alignments to ensure accurate positioning of conserved motifs

  • Conservation Analysis:

    • Calculate sequence identity and similarity scores across alignments

    • Generate conservation plots to visualize highly conserved regions

    • Identify absolutely conserved residues (potential catalytic or structural importance)

    • Detect lineage-specific acceleration or deceleration of evolutionary rates

  • Domain Architecture Analysis:

    • Identify recognized domains using tools like SMART, Pfam, and InterPro

    • Map conserved zinc metalloprotease motifs (HEXXH + additional zinc coordinating residue)

    • Detect signal peptides, transmembrane regions, and other functional elements

    • Compare domain organization across species for evidence of domain shuffling

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios across the gene length to identify domains under purifying vs. diversifying selection

    • Perform codon-based maximum likelihood tests for selection

    • Identify sites under episodic selection that might indicate host adaptation

  • Structure-Function Correlation:

    • Map conservation data onto predicted 3D structures

    • Identify surface patches with high conservation (potential interaction sites)

    • Correlate conserved sites with predicted functional residues

  • Phylogenetic Profiling:

    • Correlate presence/absence of BH06270 with host range and pathogenicity

    • Identify co-evolving genes that might function in the same pathway

    • Compare evolutionary history of BH06270 with species phylogeny to detect horizontal gene transfer events

This methodological framework allows researchers to distinguish core functional domains essential across all Bartonella species from variable regions that might contribute to host specificity or niche adaptation. The resulting insights can guide functional studies by highlighting residues and domains most likely to be critical for metalloprotease activity .

What are common challenges in expressing and purifying active recombinant BH06270?

Researchers working with recombinant BH06270 frequently encounter several challenges during expression and purification that can impact protein yield and activity:

Common Challenges and Solutions:

  • Protein Solubility Issues:

    • Challenge: Formation of inclusion bodies in E. coli expression systems

    • Solutions:

      • Reduce expression temperature to 16-20°C

      • Use solubility-enhancing fusion tags (MBP, SUMO, or TrxA)

      • Try auto-induction media instead of IPTG induction

      • Express in specialized E. coli strains (Rosetta, Origami, or SHuffle)

  • Zinc Coordination Challenges:

    • Challenge: Improper zinc incorporation affecting catalytic activity

    • Solutions:

      • Supplement expression media with 0.1-0.5 mM ZnCl₂

      • Include zinc in purification buffers (1-10 μM ZnCl₂)

      • Avoid strong chelating agents like EDTA

      • Consider dialysis against zinc-containing buffers post-purification

  • Proteolytic Degradation:

    • Challenge: Self-cleavage or degradation by host proteases

    • Solutions:

      • Use protease-deficient expression strains

      • Include protease inhibitors in all buffers

      • Maintain samples at 4°C during purification

      • Optimize purification speed to minimize exposure time

  • Protein Misfolding:

    • Challenge: Incorrect disulfide bond formation

    • Solutions:

      • Express in strains promoting disulfide formation (Origami)

      • Use controlled oxidation/reduction conditions

      • Consider chaperone co-expression systems

      • Try insect or mammalian expression systems for complex folding

  • Low Activity After Purification:

    • Challenge: Loss of enzymatic activity during purification

    • Solutions:

      • Validate protein folding using circular dichroism

      • Test different buffer conditions (pH 6.5-8.5)

      • Add stabilizing agents (glycerol, trehalose)

      • Ensure proper storage conditions with minimal freeze-thaw cycles

Addressing these challenges requires systematic optimization of expression and purification conditions specific to BH06270, often requiring iterative adjustments based on protein yield, purity, and activity assessments .

How can I validate that my recombinant BH06270 maintains its native conformation and activity?

Validating that recombinant BH06270 maintains its native conformation and activity requires a multi-faceted approach:

Validation Protocol:

  • Structural Integrity Assessment:

    • Circular Dichroism (CD) Spectroscopy: Compare secondary structure content with predictions

    • Thermal Shift Assays: Measure protein stability and proper folding

    • Size Exclusion Chromatography: Ensure monodispersity and appropriate oligomeric state

    • Dynamic Light Scattering: Confirm homogeneity and absence of aggregation

  • Zinc Coordination Verification:

    • Inductively Coupled Plasma Mass Spectrometry (ICP-MS): Quantify zinc:protein ratio

    • PAR Colorimetric Assay: Detect zinc binding capacity

    • Activity Dependence on Zinc: Test activity with and without zinc chelators (EDTA, 1,10-phenanthroline)

    • Metal Substitution Studies: Compare activity with different divalent metals (Zn²⁺, Co²⁺, Mn²⁺)

  • Functional Activity Testing:

    • Generic Substrate Hydrolysis: Use fluorogenic metalloprotease substrates (e.g., FRET peptides)

    • Kinetic Parameter Determination: Compare Km and kcat with reported values for related metalloproteases

    • pH Profile Analysis: Verify bell-shaped curve typical of metalloproteases

    • Inhibitor Sensitivity Profile: Test responsiveness to metalloprotease inhibitors

  • Structural Comparison Methods:

    • Limited Proteolysis: Compare digestion patterns of recombinant vs. native protein

    • Epitope Mapping: Test binding of conformation-specific antibodies

    • Hydrogen-Deuterium Exchange Mass Spectrometry: Assess solution dynamics and solvent accessibility

    • Small-Angle X-ray Scattering (SAXS): Compare solution structure to predictions

  • Biological Activity Verification:

    • Cell-Based Assays: Test effects on relevant host cells

    • Substrate Processing: Confirm cleavage of predicted biological substrates

    • Protein-Protein Interaction Studies: Verify binding to known partners

This comprehensive validation approach ensures that the recombinant BH06270 not only possesses the expected structural features but also retains functional activities consistent with its native form, critical for meaningful biological studies .

What emerging technologies could advance our understanding of BH06270 function in host-pathogen interactions?

Several cutting-edge technologies show promise for deepening our understanding of BH06270's role in host-pathogen interactions:

Emerging Technologies for BH06270 Research:

  • Proximity-Dependent Biotinylation (BioID/TurboID):

    • Fusing BH06270 to a biotin ligase to identify proximal interacting proteins in living cells

    • Reveals transient interactions that may be missed by traditional co-immunoprecipitation

    • Can be performed in relevant host cells during infection to capture physiologically relevant interactions

    • Potential to map the complete "interactome" of BH06270 during infection

  • CRISPR Interference/Activation Screens:

    • Genome-wide CRISPRi/CRISPRa screens to identify host factors affecting BH06270 function

    • Discover host pathways that enhance or suppress BH06270 activity

    • Identify synthetic lethal interactions that could inform therapeutic strategies

    • Map genetic networks involved in BH06270-mediated pathogenesis

  • Cryo-Electron Microscopy:

    • Determine high-resolution structure of BH06270 alone and in complex with substrates

    • Visualize conformational changes upon substrate binding

    • Capture different catalytic states of the enzyme

    • Guide structure-based drug design efforts

  • Intravital Microscopy with Fluorescent Reporters:

    • Real-time visualization of BH06270 localization during infection in animal models

    • Track protease activity using FRET-based biosensors

    • Monitor host-pathogen interactions at the cellular and tissue level

    • Correlate BH06270 activity with disease progression

  • Single-Cell Transcriptomics and Proteomics:

    • Analyze cell-specific responses to BH06270 within heterogeneous tissues

    • Identify cell populations particularly susceptible to BH06270 activity

    • Map temporal dynamics of host response to protease activity

    • Discover cell-specific biomarkers of BH06270 activity

  • Nanobody and Intrabody Development:

    • Generate conformation-specific nanobodies to trap specific states of BH06270

    • Develop intracellular antibodies (intrabodies) to inhibit BH06270 in specific subcellular compartments

    • Create biosensors for BH06270 localization and activity

    • Design novel therapeutic modalities targeting BH06270

These emerging technologies offer unprecedented opportunities to dissect BH06270 function at molecular, cellular, and organismal levels, potentially revealing new therapeutic targets and intervention strategies for Bartonella infections .

How might BH06270 contribute to Bartonella henselae virulence across different host species?

Understanding how BH06270 contributes to Bartonella henselae virulence across different host species requires comparative analysis of its activity and effects in diverse biological contexts:

Cross-Species Virulence Contribution Analysis:

  • Host Adaptation Mechanisms:

    • BH06270 may cleave host-specific immune recognition molecules

    • Substrate specificity could be optimized for primary reservoir hosts (cats) versus incidental hosts (humans)

    • Tissue tropism differences between hosts might be influenced by BH06270 activity against specific extracellular matrix components

    • Differential gene regulation may occur in response to host-specific environmental cues

  • Comparative Host Response Patterns:

    • Feline vs. human immune response to BH06270 activity may differ significantly

    • Species-specific inhibitors of metalloproteases could modulate infection outcomes

    • Varying effectiveness of BH06270 against host defense mechanisms across species

    • Potential contribution to asymptomatic carriage in reservoir hosts vs. pathology in accidental hosts

  • Vector-Host Interface:

    • BH06270 may facilitate transition from arthropod vector to mammalian host environments

    • Temperature-dependent activity profiles could enable functional transitions

    • Role in countering conserved vs. species-specific innate immune barriers

    • Potential interaction with vector salivary components during transmission

  • Evolutionary Considerations:

    • Sequence variations in BH06270 across Bartonella strains with different host preferences

    • Selection pressure analysis may reveal host-specific adaptation signatures

    • Comparison with homologs in other Bartonella species with different host tropisms

    • Convergent evolution with other bacterial metalloproteases targeting similar host pathways

Understanding these cross-species dynamics of BH06270 function could explain the variable clinical manifestations of Bartonella infections in different hosts and provide insights into the evolutionary strategies employed by this pathogen to successfully colonize diverse host species. This knowledge is crucial for developing host-specific intervention strategies and understanding zoonotic transmission dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.