Recombinant Bartonella henselae Type IV secretion system-coupling protein virD4 (virD4)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant VirD4 is a 639-amino acid protein encoded by the virD4 gene (UniProt ID: Q6G2A8) and fused to an N-terminal His tag for purification . Key specifications include:

PropertyDetail
SpeciesBartonella henselae
Expression HostEscherichia coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile water + 50% glycerol (recommended for stability)

Domain Architecture

  • N-terminal domain: Contains ATP-binding motifs critical for substrate recruitment .

  • C-terminal domain: Features a Bep-intracellular delivery (BID) fold homologous to conjugative relaxases, enabling interaction with T4SS substrates .

  • Oligomerization: Forms dimers or hexamers, essential for ATPase activity and complex stability .

Mechanistic Role in T4SS

VirD4 acts as a coupling protein that:

  1. Recognizes substrates via C-terminal BID domains and positively charged tails .

  2. Translocates effector proteins (Beps) and plasmid DNA into eukaryotic host cells .

  3. Coordinates with VirB ATPases (e.g., VirB4, VirB11) to energize substrate transfer .

DNA Transfer Capability

  • VirD4 mediates conjugative plasmid transfer into human endothelial cells (e.g., EA.hy926) at rates enhanced 100-fold by fusing BepD’s secretion signal to plasmid relaxases .

  • Transferred DNA integrates into host genomes upon cell division, enabling stable transgenic cell line generation .

ATPase Activity

  • Exhibits Mg²⁺-dependent ATP hydrolysis, stabilized by K⁺ ions .

  • Mutations in Walker A/B motifs (e.g., G420D, D633K) disrupt oligomer stability and enzymatic activity .

Pathogenic Role

  • Facilitates B. henselae’s inhibition of host apoptosis, pro-inflammatory activation, and endothelial proliferation—key to bacillary angiomatosis .

Applications in Research

  • Pathogenesis Studies: Elucidating VirB/VirD4-dependent effector translocation in endothelial cells .

  • Gene Delivery: Engineered plasmids with VirD4 secretion signals enable eukaryotic gene transfer .

  • Structural Biology: Homology modeling (e.g., Salmonella VirD4) reveals evolutionary links to conjugation systems .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
virD4; traG; BH13380; Type IV secretion system-coupling protein VirD4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-639
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
virD4
Target Protein Sequence
MKYTKTQLALISMPIASGALTIFLVPHMLSFVINDLKTNQIYWYVRSEPLLTLMLVAAVS LFYTLSQKLHLRKAITFVSTAFFCITALYYIGSEIKRLNPYVGQQGITWGYALKFMDPMV VFGVILGFVLLAIQVIITSPRTSNVKRAKKGIFGDAAWMNLKEAARIFPSNGQIVIGERY RVDQDNVRNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVPTCL TYTGPIVCLDPSTEIAPMVKFARKKMGNRNVIILDPNSLLTKNFNVLDWLLDENIPRTRR EANIVSFSKLLLSEKKSENSSAEYFSTQAHNLLTALLAHVIFSDKYEDSERNLKTLRAIL SQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQTFSGVYTTASKDTQWLSLSNYADL VCGNDFASSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGNYKKRVLFVL DEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFGEAGARSWFESCSFVSYAAI KDLQTAKDISERCGQMTIEVTGTSKSRGLSLTKGSQNINYQQRALILPHEIIQEMRQDEQ IILMQGHPPLRCGRAIYFRRKEMLAATEKNRFAPQAKKS
Uniprot No.

Target Background

Function
The type IV secretion system VirB/VirD4 is a key virulence factor responsible for disrupting human endothelial cell (HEC) function. VirB-mediated changes in HEC include extensive cytoskeletal rearrangements, pro-inflammatory activation via nuclear factor NF-kappa-B, inhibition of early and late apoptotic events resulting in enhanced cell survival. At high infection doses, a cytostatic or cytotoxic effect is observed, interfering with potent VirB-independent mitogenic activity. These alterations in HEC require the T4S coupling protein VirD4 and at least one of the effector proteins BepA-G.
Database Links

KEGG: bhe:BH13380

STRING: 283166.BH13380

Protein Families
VirD4/TraG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Bartonella henselae VirD4 protein?

Bartonella henselae VirD4 is a coupling protein that forms part of the Type IV secretion system (T4SS). Structurally, VirD4 contains Walker A and B sequence motifs that play critical roles in nucleotide binding and hydrolysis . The protein has an N-terminal transmembrane region (approximately residues 1-116) and a C-terminal region that may have lower structural confidence in homology modeling . Based on structural analyses, VirD4 shares approximately 21% sequence identity with P-loop containing nucleoside triphosphate hydrolases .

The functional VirD4 assembles into a hexameric structure forming a ring-like complex, similar to its structural homologs . Notably, compared to template structures, VirD4 contains several insertion regions (primarily 4-6 residues long) with two significant insertions of 10-15 residues that occupy connecting loops positioned away from the core structure . These insertions are hypothesized to provide flexibility for protein-protein interactions during substrate transfer .

How does the VirD4 protein function within the Type IV secretion system?

VirD4 functions as a coupling protein responsible for the initial recruitment of substrates to the T4SS. The protein initiates a multi-step process:

  • Substrate selection and processing occurs at the cytoplasmic region (relaxosome)

  • VirD4 recruits the substrate molecules

  • The substrate is transferred to VirB11 (another component of the T4SS)

  • The substrate is translocated through the secretory machinery

  • Final delivery of secretory products to host cells or other bacterial species

This orchestrated process enables Bartonella henselae to transfer both DNA and protein effectors to host cells . VirD4's role as a coupling protein is essential for the selection and delivery of substrates to the secretion channel, effectively serving as the initiator of the secretion process .

What are the homologous VirD4 systems in other bacterial species?

The VirD4 protein in Bartonella henselae shows homology to VirD4 systems in other bacteria, most notably:

  • Agrobacterium tumefaciens VirB/VirD4 T4SS - This is considered the paradigm for the T4SS superfamily and delivers oncogenic DNA (T-DNA) and effector proteins to plant cells, causing crown gall disease .

  • The VirD4 homolog in Bartonella henselae is particularly significant as it shows functional similarity to the A. tumefaciens system but operates in a human pathogen context .

  • The Bartonella henselae virB operon is homologous to the one in Agrobacterium tumefaciens, though their specific roles in virulence are still under investigation .

Structural analysis indicates that despite having only 21% sequence identity with template structures like the P-loop containing nucleoside triphosphate hydrolase, the structural fold is highly conserved, suggesting functional conservation across different bacterial species .

What experimental approaches have been used to characterize the VirD4 ATPase binding site and substrate interactions?

Several sophisticated methodologies have been employed to characterize the VirD4 ATPase binding site:

  • Homology Modeling and Structural Prediction:

    • Protein fold recognition servers (Phyre2) and Swiss model have been used to predict structural folding based on sequence similarity

    • Quality assessment using RMSD values during structural alignment and Z-score values (DALI search)

    • Energy minimization using SYBYL with inspection via WINCOOT to detect potential clashes between side chain residues

    • Stereochemical assessment using PROCHECK

  • Cavity and Binding Site Prediction:

    • CASTp program analysis of protein topology to predict concave cavities, surface area, and location

    • Protein structural fold search engine identification of functional sites

  • Ligand Docking Studies:

    • CB-DOCK and 3D-ligand docking for validation of predicted binding sites

    • Conversion of the VirD4 homology model to pdbqt format for docking purposes

    • ADP ligand generation and conversion to SDF file format for docking

These approaches have revealed that the Walker A and B motifs are involved in ligand binding, providing insight into the nucleotide binding mechanisms that power VirD4 function .

How has the mechanism of Bartonella henselae VirD4-mediated DNA transfer into human cells been demonstrated experimentally?

The revolutionary finding that Bartonella henselae can transfer DNA into human cells via its VirB/VirD4 T4SS has been demonstrated through several elegant experimental approaches:

  • Reporter Plasmid System: Researchers generated a reporter derivative of a Bartonella-specific mobilizable plasmid by inserting a eukaryotic egfp-expression cassette .

  • Fusion Protein Engineering: Creating a fusion of the C-terminal secretion signal of the endogenous VirB/VirD4 protein substrate BepD with the plasmid-encoded DNA-transport protein Mob resulted in a remarkable 100-fold increased DNA transfer rate .

  • Cell Division Requirement: Experiments showed that expression of the delivered egfp gene in EA.hy926 human endothelial cells required cell division. This suggests that nuclear envelope breakdown may facilitate passive entry of the transferred single-stranded DNA into the nucleus as a prerequisite for complementary strand synthesis and transcription .

  • Stable Transgenic Cell Line Creation: By adding an eukaryotic neomycin phosphotransferase expression cassette to the reporter plasmid, researchers were able to select stable transgenic EA.hy926 cell lines displaying chromosomal integration of the transferred plasmid DNA .

These methodologies collectively demonstrated that Bartonella henselae is capable of inter-kingdom DNA transfer from bacteria to human cells, making it only the second bacterium known to naturally transfer DNA into eukaryotic cells via a T4SS after Agrobacterium tumefaciens .

What are the structural determinants that enable VirD4 to form functional interactions within the T4SS complex?

The functional interactions of VirD4 within the T4SS complex are facilitated by several structural determinants:

  • Hexameric Assembly: VirD4 forms a hexameric structure that creates a ring-like complex, enabling it to interact with other components of the T4SS machinery .

  • Strategic Insertion Regions: VirD4 contains multiple insertion regions compared to template structures:

    • Two major insertion regions of 10-15 residues length occupy strategic positions

    • One insertion is positioned in the connecting loop at the bottom of the hexamer

    • The second insertion forms a donut-like structure at the top of the core structure

    • These insertions are hypothesized to provide flexibility for interactions with partner proteins during substrate transfer to VirB11

  • Nucleotide Binding Domains: The Walker A and B motifs form a nucleotide binding pocket that enables ATP binding and hydrolysis, providing the energy required for substrate recruitment and transfer .

  • Transmembrane Domain: The N-terminal transmembrane region (residues 1-116) anchors VirD4 to the bacterial inner membrane, positioning it appropriately within the T4SS architecture .

This strategic organization allows VirD4 to serve as the initiator of the secretion process, recruiting substrates and delivering them to the secretion channel through coordinated interactions with other T4SS components .

What protocols can be used to produce recombinant Bartonella henselae VirD4 protein for structural and functional studies?

Production of recombinant Bartonella henselae VirD4 requires careful consideration of its structural features and functional integrity. Based on research methodologies, the following protocol framework is recommended:

  • Gene Cloning and Expression Vector Construction:

    • PCR amplification of the virD4 gene from Bartonella henselae genomic DNA

    • Consider removing the N-terminal transmembrane region (residues 1-116) for improved solubility

    • Clone into an expression vector with an appropriate tag (His-tag or GST-tag)

    • For specific interaction studies, construct fusion proteins with the C-terminal secretion signal of endogenous VirB/VirD4 protein substrates (such as BepD)

  • Expression System Selection:

    • E. coli BL21(DE3) for basic structural studies

    • Consider membrane-compatible expression systems for full-length protein including the transmembrane domain

  • Protein Purification Strategy:

    • For constructs without the transmembrane domain:

      • Affinity chromatography using the fusion tag

      • Ion exchange chromatography

      • Size exclusion chromatography to isolate the hexameric form

    • For full-length constructs:

      • Detergent solubilization (e.g., DDM, LDAO)

      • Affinity purification in the presence of detergent

      • Consider amphipol or nanodisc reconstitution for functional studies

  • Quality Control Assessment:

    • SDS-PAGE and Western blotting

    • Dynamic light scattering to assess oligomeric state

    • Circular dichroism for secondary structure confirmation

    • ATPase activity assay using colorimetric phosphate detection

  • Structural Analysis Preparation:

    • Negative stain electron microscopy to confirm hexameric assembly

    • Crystal trials for X-ray crystallography

    • Sample preparation for cryo-EM analysis

Each step should be optimized specifically for VirD4, with particular attention to maintaining the native oligomeric state and nucleotide binding capability.

What experimental systems can be used to study VirD4-mediated DNA transfer into human cells?

To investigate VirD4-mediated DNA transfer into human cells, researchers can employ the following experimental systems:

  • Reporter Plasmid Construction:

    • Generate a Bartonella-specific mobilizable plasmid containing eukaryotic expression cassettes

    • Include fluorescent protein genes (like egfp) under eukaryotic promoters to visualize successful transfer

    • Add selectable markers (e.g., neomycin phosphotransferase) for stable integration studies

  • Cell Culture Models:

    • Human endothelial cell lines (e.g., EA.hy926) that have been validated for Bartonella infection

    • Primary human endothelial cells for physiologically relevant studies

    • Cell division synchronization protocols to study nuclear envelope breakdown requirements

  • Bacterial Strains and Modifications:

    • Wild-type Bartonella henselae expressing the complete VirB/VirD4 T4SS

    • Mutant strains with deletions or modifications in specific VirD4 domains

    • Fusion constructs combining the C-terminal secretion signal of VirB/VirD4 protein substrates with DNA-transport proteins (e.g., Mob) for enhanced transfer rates

  • Transfer Detection and Quantification Methods:

    • Flow cytometry to quantify the percentage of cells expressing fluorescent markers

    • Fluorescence microscopy for visualization of successful DNA transfer

    • PCR and sequencing to confirm presence and integrity of transferred DNA

    • Selection of stable transformants using antibiotics corresponding to resistance markers

  • Advanced Analysis Techniques:

    • Cell cycle analysis to correlate DNA transfer with nuclear envelope breakdown

    • Chromatin immunoprecipitation to study integration patterns

    • RNA-seq to analyze host cell transcriptional responses to DNA transfer

    • Live-cell imaging to visualize the DNA transfer process in real-time

This methodological framework provides a comprehensive approach to study the unique ability of Bartonella henselae to transfer DNA into human cells via its T4SS, offering insights into both basic biology and potential biotechnological applications .

How can researchers investigate the structural dynamics and conformational changes of VirD4 during substrate recruitment and transfer?

Investigating the structural dynamics and conformational changes of VirD4 during its functional cycle requires sophisticated biophysical and biochemical approaches:

  • Time-resolved Cryo-electron Microscopy:

    • Capture different conformational states of VirD4 during the ATP binding, hydrolysis, and substrate transfer cycle

    • Use ATP analogs (e.g., AMP-PNP, ADP-AlF₄) to trap specific conformational states

    • Compare structures with and without bound substrates

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map regions of VirD4 that undergo conformational changes during substrate binding

    • Identify protected regions that form interaction interfaces with other T4SS components

    • Compare exchange patterns in different nucleotide-bound states

  • Fluorescence Resonance Energy Transfer (FRET) Studies:

    • Engineer VirD4 constructs with strategically placed fluorophores

    • Monitor real-time conformational changes during substrate recruitment and ATP hydrolysis

    • Investigate interactions with other T4SS components like VirB11

  • Molecular Dynamics Simulations:

    • Model the conformational flexibility of insertion regions hypothesized to provide interaction flexibility

    • Simulate nucleotide binding and release events

    • Predict structural changes associated with hexameric assembly

  • Site-directed Mutagenesis and Functional Assays:

    • Target residues in the Walker A and B motifs to assess their role in ATP binding and hydrolysis

    • Modify the insertion regions to test their role in flexibility and protein interactions

    • Develop quantitative assays to measure substrate recruitment efficiency

  • Single-molecule Techniques:

    • Optical tweezers or atomic force microscopy to measure forces associated with VirD4-mediated transport

    • Single-molecule FRET to detect conformational changes at the individual molecule level

    • Total internal reflection fluorescence microscopy to visualize substrate recruitment events

This multi-faceted approach would provide unprecedented insights into how VirD4's structural dynamics enable its function as the initiator of the type IV secretion process, particularly focusing on the proposed flexibility provided by its unique insertion regions during substrate transfer to VirB11 .

What are the potential applications of Bartonella henselae VirD4-mediated DNA transfer for gene therapy and DNA vaccination?

The discovery that Bartonella henselae can transfer DNA into human cells via its VirB/VirD4 T4SS opens several promising avenues for biotechnological applications:

  • Gene Therapy Vector Development:

    • B. henselae could potentially serve as an engineered in vivo gene-delivery vector

    • Advantages include the natural ability to target endothelial cells and the capacity to achieve stable chromosomal integration of transferred DNA

    • The system could be engineered for tissue-specific targeting by modifying surface adhesins

  • DNA Vaccination Platforms:

    • B. henselae's ability to transfer DNA directly into human cells makes it a candidate for delivering DNA vaccines

    • The capacity for chromosomal integration could potentially provide long-term antigen expression

    • The natural targeting of endothelial cells might be advantageous for inducing robust immune responses

  • Current Limitations and Research Needs:

    • Safety considerations must be addressed, including attenuating pathogenicity while maintaining DNA transfer capability

    • Transfer efficiency needs enhancement for therapeutic levels of gene expression

    • Regulatory and immune evasion strategies must be developed for in vivo applications

  • Comparative Advantages:

    • Unlike viral vectors, bacterial vectors potentially offer larger DNA cargo capacity

    • The natural process of T4SS-mediated DNA transfer may avoid some of the immune recognition issues faced by viral vectors

    • The fusion of the C-terminal secretion signal of BepD with the Mob protein demonstrated a 100-fold increase in transfer efficiency, suggesting engineering potential

These applications remain in early research stages but suggest that B. henselae's unique DNA transfer capability could eventually contribute to novel therapeutic approaches in gene therapy and vaccination .

How can researchers investigate the evolutionary relationship between DNA transfer systems in Bartonella henselae and Agrobacterium tumefaciens?

Investigating the evolutionary relationship between the DNA transfer systems of Bartonella henselae and Agrobacterium tumefaciens requires a multifaceted approach:

  • Comparative Genomics and Phylogenetic Analysis:

    • Construct phylogenetic trees of VirD4 proteins and other T4SS components across bacteria

    • Analyze synteny of T4SS gene clusters to identify conservation patterns

    • Examine codon usage and GC content to detect potential horizontal gene transfer events

    • Identify genomic islands that may indicate acquisition of T4SS components

  • Structural Comparative Analysis:

    • Compare the 3D structures of VirD4 proteins from both species

    • Identify conserved domains and species-specific adaptations

    • The homology between the virB operon in B. henselae and A. tumefaciens provides a starting point

  • Functional Domain Swapping Experiments:

    • Create chimeric proteins combining domains from both species' VirD4 proteins

    • Test functionality in both plant and human cell transfer systems

    • Identify domains responsible for host specificity

  • Comparative Mechanistic Studies:

    • The A. tumefaciens VirB/VirD4 T4SS delivers oncogenic DNA to plant cells, while B. henselae transfers DNA to human cells

    • Investigate differences in substrate recognition and processing

    • Compare the relaxosome components and DNA processing mechanisms

  • Host Range Experiments:

    • Test whether engineered A. tumefaciens can transfer DNA to animal cells

    • Determine if B. henselae can be modified to transfer DNA to plant cells

    • Identify barriers to cross-kingdom transfer

This research would provide insights into how T4SS systems evolved from ancestral conjugation systems for specialized purposes relating to bacterial colonization or infection , and how two phylogenetically distant pathogens developed similar mechanisms for inter-kingdom DNA transfer targeting different eukaryotic hosts.

What are the current challenges in developing inhibitors targeting VirD4 function for antimicrobial applications?

Developing inhibitors targeting VirD4 function presents several challenges that researchers must address:

  • Structural Knowledge Limitations:

    • Limited availability of high-resolution VirD4 structures

    • Incomplete understanding of the dynamic conformational changes during substrate recruitment

    • Challenges in crystallizing membrane-associated proteins with transmembrane domains

  • Target Site Identification:

    • Multiple potential target sites including:

      • ATP binding pocket formed by Walker A and B motifs

      • Substrate recognition and binding interfaces

      • Protein-protein interaction surfaces with other T4SS components

    • Each site presents different challenges for inhibitor design and specificity

  • Selectivity Considerations:

    • VirD4 shares structural similarity with other ATPases

    • Ensuring specificity for bacterial VirD4 over human ATPases

    • Differentiating between VirD4 proteins of pathogenic versus commensal bacteria

  • Delivery and Bioavailability:

    • Need for inhibitors to penetrate bacterial membranes

    • Potential requirement for intracellular delivery if targeting bacteria within host cells

    • Stability concerns in the context of infection microenvironments

  • Resistance Development:

    • Potential for mutations in VirD4 that maintain function but evade inhibition

    • Possibility of bacteria utilizing alternative secretion systems

    • Need for combination approaches targeting multiple T4SS components

Potential VirD4 Target SitesAdvantagesChallenges
ATP Binding Pocket (Walker A/B)Well-defined binding site; Essential for functionSimilar to other ATPases; Potential off-target effects
Insertion RegionsUnique to VirD4; Involved in protein interactions Flexible regions difficult to target; Limited structural data
Hexamer InterfaceCritical for oligomerization; Species-specific featuresComplex interaction surface; Conformational dynamics
Substrate Binding RegionDirect inhibition of transport functionPoorly characterized; May vary depending on substrate

Addressing these challenges requires integrated approaches combining structural biology, medicinal chemistry, and innovative delivery strategies to develop effective VirD4 inhibitors as a novel class of antimicrobials targeting a mechanism essential for bacterial pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.