Recombinant Bartonella henselae Type IV secretion system protein virB10 (virB10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bartonella henselae VirB10

Bartonella henselae is a bacterium known to cause cat-scratch disease in humans and is a zoonotic pathogen carried by cats . B. henselae uses a type IV secretion system (T4SS) VirB to interact with human endothelial cells . The VirB T4SS is essential for the bacterium to infect mammalian hosts . Specifically, VirB10 is a component of the VirB/D4 T4SS, which functions to transfer substrates into host cells . VirB10 is an inner membrane protein that undergoes structural changes when ATP is used by VirD4 and VirB11 ATPases .

VirB10 Structure and Function

VirB10 is a bitopic inner membrane protein, meaning it has two transmembrane domains . It is crucial for the assembly of the T4SS core complex . VirB10 acts as an energy sensor, detecting ATP utilization by VirD4 and VirB11, which leads to a structural change required for stable complex formation with VirB7-VirB9 .

VirB10 domains facilitate several functions :

  • Anchoring at the inner membrane

  • Extending across the periplasm via its proline-rich region (PRR)

  • Interacting with the VirB7-VirB9 channel complex through its β-barrel domain

Role of VirB10 in Type IV Secretion System

The VirB/D4 T4SS, including VirB10, plays a vital role in several key processes :

  • Mediating invasion of endothelial cells

  • Causing proinflammatory activation

  • Providing antiapoptotic protection to endothelial cells

The T4SS modulates endothelial cell functions, making it a crucial element for this vasculotropic pathogen .

VirB10 Interactions

VirB10 interacts with other VirB proteins to form a functional secretion system. Studies using the yeast two-hybrid system have identified interactions between inner membrane and periplasmic proteins, the pilus polypeptide, and the core complex, including a novel interaction between VirB3 and VirB5 .

VirB10 and ATP-Mediated Conformational Changes

VirB10 undergoes a structural transition upon sensing ATP utilization by VirD4 and VirB11 . This transition is essential for the stable formation of a complex with the VirB7–VirB9 heterodimer, bridging the inner and outer membranes . The ATP-dependent conformational switch in VirB10 correlates with substrate transfer from inner membrane proteins (VirB6 and VirB8) to periplasmic and outer membrane channel components (VirB2 and VirB9) .

VirB10 Regulation

The expression of the virB operon, which includes VirB10, is driven from the P virB2 promoter, controlled by the BatR/BatS two-component system . The BatR/BatS system is a conserved regulator of host interactions in Bartonella .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag type, please inform us, and we will prioritize its development.
Synonyms
virB10; BH13340; Type IV secretion system protein virB10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
virB10
Target Protein Sequence
MNDPMDENNLLNDRDMIKDGHGKKQRPNTSKAAALVILFGVCLYLAYSTLFTEKQQPVEV QKEGIIKQTELFRPAPPKPVSLEPTIEKNNVLLPKVELPTPPKKTTNSDDSLLEAAQRAP VLAYANTQKGQGSTEKNKDISANQPEAKPDETAQRFNHLLKPTTLEGIRAAKLGNRNYII AMGASIPCILETAISSDQQGFASCIVSRDILSDNGRVVLLDKGTQIVGEYRAGLKKGQKR LFVLWNRAKTPNGIIITLASPATDALGRSGMDGDIDNHWLERIGSALLVSIVKDATNYVK GRLPKDQDKNNSETISSGQNIANIAVENYANIPPTLSKNQGEMVNVFVARDLDFSNVYKL KVIENKKQIVNRALSRNFYKNSAVICNEPKLAHIER
Uniprot No.

Target Background

Function

The type IV secretion system VirB/VirD4 is a key virulence factor in the subversion of human endothelial cell (HEC) function. VirB-mediated alterations in HEC include significant cytoskeletal rearrangements, pro-inflammatory activation via nuclear factor NF-κB, inhibition of early and late apoptotic events (resulting in increased cell survival), and, at high infection doses, cytostatic or cytotoxic effects that interfere with potent VirB-independent mitogenic activity. These HEC modifications require the T4S coupling protein VirD4 and at least one of the effector proteins BepA-G.

Database Links

KEGG: bhe:BH13340

STRING: 283166.BH13340

Protein Families
TrbI/VirB10 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structure and function of VirB10 in the Bartonella henselae Type IV Secretion System?

VirB10 is a critical structural and functional component of the Bartonella henselae Type IV Secretion System (T4SS). It functions as an ATP energy sensor that mediates assembly and functionality of the VirB/D4 T4SS complex . The protein spans the bacterial cell envelope, connecting the inner membrane (IM) and outer membrane (OM) components of the secretion apparatus. VirB10 undergoes ATP-dependent conformational changes that are essential for its function in substrate transfer across the bacterial cell envelope .

Structurally, VirB10 contains domains that enable it to interact with multiple T4SS components, particularly VirB9 and VirD4. These interactions are differentially regulated - the ATP-induced conformational change in VirB10 is required for complex formation with the outer membrane-associated VirB9 protein, but not for interaction with the inner membrane VirD4 coupling protein (T4CP) . This dual interaction capability allows VirB10 to serve as a bridge between the inner and outer membrane complexes of the secretion system.

How does VirB10 contribute to the pathogenicity of Bartonella henselae?

VirB10, as an integral component of the B. henselae VirB/VirD4 T4SS, plays an essential role in the pathogen's ability to translocate effector proteins into host cells during infection. The VirB/VirD4 T4SS mediates the delivery of Bartonella effector proteins (Beps) into human endothelial cells, which is crucial for establishing successful infection . These effector proteins manipulate host cell functions to create a favorable environment for bacterial persistence.

The T4SS of B. henselae has been demonstrated to transfer DNA into human endothelial cells (EA.hy926 cell line), a process in which VirB10 plays a critical role as part of the secretion channel apparatus . This DNA transfer capability may naturally occur during human infection and contributes to the pathogen's ability to establish chronic infections . The intact functioning of VirB10 is necessary for substrate transfer across the bacterial cell envelope, as mutations in VirB10 block T-DNA substrate transfer from inner membrane channel subunits to periplasmic and outer membrane components .

What evolutionary patterns are observed in the virB gene cluster of Bartonella species?

Multiple recombination events have been identified within the virB gene cluster, which encodes components of the type IV secretion system essential for the infection process . This increased recombination rate appears to be driven by selection for sequence variability in genes encoding the secretion system. The enhanced recombination in the virB cluster is particularly noteworthy given that nucleotide sequence divergence levels in B. henselae strains are generally less than 1% .

This pattern suggests that while B. henselae maintains a largely stable genome (indicative of a closed pan-genome with little novel gene acquisition), specific gene clusters involved in host interaction, particularly the virB cluster, undergo accelerated evolution through recombination . This selective enhancement of genetic variability in virulence-associated genes likely represents an adaptation mechanism that facilitates host infection and persistence.

What techniques can be used to study VirB10 conformational changes in response to ATP?

Several experimental approaches can be employed to investigate the ATP-dependent conformational changes in VirB10:

Immunoprecipitation assays: These can be used to analyze VirB10 interactions with other T4SS components under different energy conditions. As demonstrated in previous research, anti-VirB10 antibodies can be used to coprecipitate VirB10 and its interacting partners from bacterial extracts under various treatment conditions (untreated, energy-depleted with CCCP or arsenate, etc.) . Changes in interaction patterns reflect conformational alterations in VirB10.

Cross-linking studies: Chemical cross-linking followed by mass spectrometry can capture transient conformational states of VirB10 in response to ATP binding or hydrolysis. This approach helps identify specific residues involved in the conformational changes.

ATP depletion experiments: Researchers can employ protonophores like CCCP (carbonyl cyanide m-chlorophenylhydrazone) or metabolic inhibitors like arsenate to deplete cellular ATP levels and observe the effects on VirB10 structure and interactions . The data in Table 1 summarizes the effects of different energy depletion approaches on VirB10 conformational state:

TreatmentATP StatusVirB10-VirB9 Complex FormationVirB10-VirD4 Complex Formation
UntreatedNormalDetectedDetected
H₂O/EtOHNormalDetectedDetected
CCCPDepletedNot detectedDetected
ArsenateDepletedNot detectedDetected

Site-directed mutagenesis: Creating specific mutations in residues suspected to be involved in ATP sensing or conformational changes can help identify critical regions of VirB10. Mutant proteins can then be analyzed for their ability to undergo conformational changes and interact with other T4SS components.

How can researchers effectively analyze VirB10 interactions with other T4SS components?

Studying VirB10 interactions with other T4SS components requires a multi-faceted approach:

Co-immunoprecipitation (Co-IP): This technique can identify protein-protein interactions in vivo. For example, anti-VirB10 antibodies can precipitate VirB10 and co-precipitate interacting partners like VirB9 . Similarly, anti-VirD4 antibodies can be used to detect VirB10-VirD4 interactions. The choice of detergent for cellular lysis is critical to maintain membrane protein interactions.

Yeast two-hybrid analysis: This method has been successfully used to detect VirB10 interactions with VirB9 . It is particularly useful for initial screening of potential interaction partners.

Blue native PAGE: This technique can be employed to identify native protein complexes containing VirB10 and determine their approximate molecular weights, which provides insights into the composition of these complexes.

Bacterial two-hybrid systems: These can verify direct interactions between VirB10 and other T4SS components in a bacterial cellular environment, which may better approximate the native conditions than yeast-based systems.

FRET (Fluorescence Resonance Energy Transfer): By tagging VirB10 and potential interaction partners with appropriate fluorophores, researchers can detect interactions through energy transfer measurements, which also provides spatial information about the interacting proteins.

VirB10 has been shown to interact differently with various T4SS components depending on energy status. For example, VirB10 interaction with the VirB7-VirB9 heterodimer at the outer membrane requires ATP-binding-dependent activities of VirD4 and VirB11, while VirB10 interaction with VirD4 at the inner membrane does not require cellular energy .

What methodological approaches are effective for studying the role of VirB10 in substrate transfer?

Several specialized techniques can be employed to investigate VirB10's role in substrate transfer:

Transfer DNA Immunoprecipitation (TrIP) assay: This technique allows researchers to track the passage of DNA substrates through the T4SS complex. The standard TrIP assay can detect qualitative blocks in substrate transfer, while the Quantitative TrIP (QTrIP) assay can measure the efficiency of substrate transfer to different T4SS components in the presence or absence of VirB10 . Using this approach, researchers have demonstrated that VirB10 is essential for T-DNA substrate transfer from inner membrane components (VirB6 and VirB8) to periplasmic and outer membrane components (VirB2 and VirB9) .

GFP reporter systems: For B. henselae specifically, researchers have developed reporter systems using a Bartonella-specific mobilizable plasmid with a eukaryotic GFP expression cassette to monitor DNA transfer into human cells . This approach can be modified to assess how mutations in VirB10 affect DNA transfer efficiency.

Selective marker transfer: By incorporating selectable markers (such as neomycin phosphotransferase) into transfer substrates, researchers can quantify successful DNA transfer events that result in stable integration into recipient cell genomes .

Electron microscopy: Cryo-electron microscopy or tomography can visualize the T4SS apparatus and potentially capture substrate transfer events, providing structural insights into VirB10's role in creating a continuous secretion channel.

Based on previous studies, VirB10 appears to be critical for the latter stages of substrate transfer, particularly the movement of substrates from inner membrane components to the periplasmic and outer membrane components of the T4SS .

How do ATP-binding activities of VirD4 and VirB11 influence VirB10 function and complex formation?

The ATP-binding activities of VirD4 and VirB11 have distinct effects on VirB10 function and complex formation:

VirD4 and VirB11 contain Walker A motifs essential for ATP binding. When these motifs are mutated (e.g., VirD4K152Q or VirB11K175Q), the resulting proteins lose ATP-binding capability . Studies show that these ATP-binding defective mutants have specific effects on VirB10 interactions.

Anti-VirB10 antibodies fail to coprecipitate VirB9 from extracts of strains producing VirD4K152Q or VirB11K175Q mutant proteins, indicating that the ATP-binding activities of both VirD4 and VirB11 are required for VirB10-VirB9 complex formation . This suggests that ATP binding by these components triggers energy-dependent conformational changes in VirB10 that enable its interaction with the VirB7-VirB9 heterodimer at the outer membrane.

Interestingly, the VirB10-VirD4 interaction is not dependent on ATP binding. Anti-VirD4 antibodies can coprecipitate VirD4K152Q (ATP-binding defective) and VirB10, indicating that ATP binding by VirD4 is not required for its interaction with VirB10 . Similarly, VirD4 and VirB10 can be coprecipitated from extracts of strains lacking VirB11 or producing VirB11K175Q.

These findings reveal a complex energy-sensing mechanism wherein VirB10 acts as an ATP energy sensor that responds to the ATP-binding states of both VirD4 and VirB11 to coordinate assembly and function of the T4SS. This energy-dependent regulation ensures that the secretion channel forms only when all components are properly energized for substrate transfer.

What is the significance of recombination events in the virB gene cluster of Bartonella henselae?

The virB gene cluster in Bartonella henselae shows remarkably enhanced recombination frequencies compared to the rest of the genome, which has significant evolutionary and functional implications:

This elevated recombination rate in the virB cluster appears to be driven by selection for sequence variability. The virB genes encode components of the type IV secretion system that play essential roles in the infection process, making them critical virulence factors . The increased genetic diversity generated through recombination may provide several adaptive advantages:

  • Enhanced evasion of host immune responses through antigenic variation

  • Adaptation to different host environments or cell types

  • Optimization of effector protein translocation efficiency

  • Acquisition of novel functional capabilities through genetic exchange

How does VirB10 function as a bridge between inner and outer membrane complexes of the T4SS?

VirB10 serves as a critical bridging component between the inner and outer membrane complexes of the T4SS through its unique structural and functional properties:

VirB10 adopts distinct conformations and interactions depending on the energetic state of the cell. Under normal ATP conditions, VirB10 can simultaneously interact with VirD4 at the inner membrane and the VirB7-VirB9 heterodimer at the outer membrane, effectively spanning the entire cell envelope . This bridging function is essential for creating a continuous secretion channel through which substrates can pass from the cytoplasm to the exterior.

The ATP-dependent conformational change in VirB10 is specifically required for its interaction with the VirB7-VirB9 heterodimer but not for its interaction with VirD4 . This differential regulation allows VirB10 to maintain contact with the inner membrane machinery while conditionally engaging with the outer membrane components when the system is properly energized.

Experimental evidence shows that VirB10 influences substrate transfer across the entire envelope. In the absence of VirB10, inner membrane channel components (VirD4, VirB11, VirB6, and VirB8) bind the T-DNA substrate less efficiently, and substrate transfer to periplasmic and outer membrane components (VirB2 and VirB9) is blocked . This suggests that VirB10 not only physically connects the inner and outer membrane complexes but also actively facilitates substrate movement through the secretion channel.

This bridging function makes VirB10 a critical regulator of T4SS assembly and function, ensuring that the secretion channel forms only when all components are properly positioned and energized for efficient substrate transfer.

What potential does the B. henselae T4SS have for gene delivery applications in human cells?

The B. henselae VirB/VirD4 T4SS shows considerable promise as a gene delivery platform for human cells with potential applications in DNA vaccination and therapeutic gene therapy:

B. henselae can transfer plasmid DNA into human endothelial cells via its VirB/VirD4 T4SS, as demonstrated using a reporter derivative of a Bartonella-specific mobilizable plasmid carrying a eukaryotic GFP expression cassette . This capability represents the first documented case of T4SS-mediated DNA transfer from a human bacterial pathogen into human cells.

The efficiency of DNA transfer can be significantly enhanced (approximately 100-fold) by fusing the C-terminal secretion signal of the endogenous VirB/VirD4 protein substrate BepD to the plasmid-encoded DNA-transport protein Mob . This fusion creates a more efficient "pilot protein" for DNA transfer, similar to the VirD2 protein in Agrobacterium tumefaciens.

Successful expression of transferred genes in human cells has been demonstrated, and the addition of an eukaryotic neomycin phosphotransferase expression cassette to reporter plasmids has facilitated selection of stable transgenic cell lines that display chromosomal integration of the transferred DNA . This indicates that the system can potentially be used for stable genetic modification of human cells.

Key advantages of the B. henselae T4SS as a gene delivery system include:

  • It is already adapted to human cells, unlike other bacterial gene transfer systems

  • It may allow transfer of very large DNA segments such as bacterial artificial chromosomes, which is challenging for most established gene delivery systems

  • It represents a bacterial system that has naturally evolved to efficiently interact with human cells

Future development of this system would require improvements in nuclear targeting and genomic integration efficiency to enhance gene expression in recipient cells . The system could potentially be optimized for in vivo applications such as DNA vaccination or targeted gene therapy.

How can structural analysis of VirB10 inform antimicrobial drug design targeting bacterial T4SS?

Structural analysis of VirB10 provides several promising avenues for antimicrobial drug development targeting bacterial T4SS:

VirB10 occupies a central position in the T4SS architecture and undergoes ATP-dependent conformational changes essential for secretion system function . This makes it an attractive target for inhibitor development. Structural studies can identify specific domains or residues involved in these conformational changes that could be targeted by small molecule inhibitors.

The ATP-sensing mechanism of VirB10 represents a particularly promising target. Compounds that lock VirB10 in its ATP-depleted conformation would prevent proper assembly of the T4SS and block substrate transfer . This would effectively disable a key virulence mechanism used by B. henselae and potentially other pathogens that employ similar secretion systems.

VirB10's interactions with multiple T4SS components, particularly the interfaces between VirB10 and VirB9 or VirD4, present additional opportunities for inhibitor design . Drugs that disrupt these protein-protein interactions would prevent proper assembly of the secretion apparatus. The differential energy requirements for these interactions suggest that it might be possible to develop inhibitors that selectively target specific interfaces.

Targeting the VirB/VirD4 T4SS would be particularly valuable for treating infections caused by intracellular pathogens like Bartonella, as these bacteria often establish persistent infections that are difficult to eradicate with conventional antibiotics. Furthermore, since T4SS are not present in human cells, drugs targeting these systems would likely have minimal side effects.

The development of T4SS inhibitors based on VirB10 structural data could potentially lead to a new class of anti-virulence drugs that disarm pathogens without directly killing them, potentially reducing selective pressure for resistance development.

What mechanisms explain the differential recombination rates observed in the B. henselae genome?

The dramatically different recombination rates observed across the B. henselae genome, particularly the elevated rates in the virB gene cluster, likely result from several interconnected mechanisms:

Several potential mechanisms may explain this pattern:

Selection for antigenic variation: Components of the T4SS exposed on the bacterial surface may be under immune selection pressure, driving the fixation of recombination events that generate sequence diversity in these regions . This would allow bacteria to evade host immune recognition while maintaining the core functionality of the secretion system.

Recombination hotspots: The virB gene cluster may contain DNA sequence features that promote recombination, such as chi sites or regions of DNA secondary structure that facilitate strand exchange during homologous recombination.

Horizontal gene transfer: The enhanced recombination in T4SS genes may reflect more frequent horizontal acquisition of genetic material from related Bartonella species. Studies of a gene involved in iron metabolism showed horizontal gene transfers across Bartonella species with different host preferences, suggesting a mechanism for adaptation to new hosts .

Relaxed purifying selection: While much of the B. henselae genome is under strong purifying selection (maintaining a low mutation rate), T4SS components may experience relaxed selection constraints that allow greater sequence variation without compromising function.

How does expression of delivered genetic material in human cells differ from conventional gene delivery systems?

Expression of genetic material delivered by the B. henselae T4SS into human cells exhibits several distinctive characteristics compared to conventional gene delivery systems:

Cell division dependency: Expression of the delivered GFP gene in human endothelial cells requires cell division, suggesting that nuclear envelope breakdown during mitosis facilitates passive entry of the transferred single-stranded DNA (ssDNA) into the nucleus . This requirement differs from viral vectors that can often access the nucleus independent of the cell cycle state.

Processing requirements: The transferred DNA must undergo complementary strand synthesis within the recipient cell before gene expression can occur . This is similar to some viral systems that deliver single-stranded genomes, but differs from conventional plasmid-based systems that deliver double-stranded DNA.

Integration patterns: The B. henselae T4SS can facilitate stable integration of transferred DNA into the host cell genome, allowing for the selection of transgenic cell lines . This integration appears to occur through recombination with the host cell genome, though the exact mechanisms and preferential integration sites remain to be fully characterized.

Delivery limitations: While the system has shown promise for DNA delivery, it currently lacks the efficient ssDNA protection and nuclear delivery systems found in more evolved gene delivery vectors . This represents both a challenge and an opportunity for system optimization.

Size capacity: Unlike most established gene delivery systems, the conjugative DNA transfer mechanism of the T4SS potentially allows the transfer of very large DNA segments such as bacterial artificial chromosomes . This capacity for large-insert delivery could be advantageous for applications requiring transfer of multiple genes or large genomic regions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.