Recombinant Bartonella henselae Type IV secretion system protein virB3 (virB3)

Shipped with Ice Packs
In Stock

Description

Functional Role in the VirB/D4 T4SS

VirB3 is essential for the structural and functional integrity of the T4SS, which drives the pathogenicity of B. henselae. Key roles include:

Host Cell Interactions

  • Effector Protein Delivery: Enables translocation of Beps (e.g., BepA–G) into endothelial cells, modulating immune responses and promoting cellular proliferation .

  • Invasome Formation: Indirectly supports bacterial aggregate internalization via F-actin rearrangements .

Research Findings and Interactions

Studies have elucidated critical interactions and functional insights:

Protein-Protein Interactions

Interaction PartnerInteraction TypeFunctional Implication
VirB5High-affinity binding (β-galactosidase assay) Stabilizes pilus structure and energy transmission
VirB4Indirect (via VirB10) Influences membrane localization and T4SS assembly
VirB9Homodimerization Modulates T4SS core complex stability

Localization and Regulation

  • Outer Membrane Localization: Depends on VirB4, which prevents misfolding and degradation .

  • Homo-Oligomerization: Forms stable dimers, critical for structural integrity .

Production and Characterization

The recombinant VirB3 (His-tagged) is produced in E. coli and purified via nickel affinity chromatography. Key characteristics include:

PropertyDetail
Yeast Two-Hybrid (YTHS)Confirmed interaction with VirB5 (MBP-VirB5 coelution assays)
StabilityRequires storage at -20°C/-80°C to prevent degradation
ReconstitutionSuggested in deionized water with 5–50% glycerol for long-term storage

Applications in Research and Pathogenesis

  • Vaccine Development: Serves as a candidate antigen for targeting T4SS-mediated pathogenicity .

  • Drug Targeting: Studies focus on disrupting VirB3-VirB5 interactions to impair pilus formation .

  • Structural Biology: Used to map T4SS protein networks and elucidate secretion mechanisms .

Challenges and Future Directions

  • Host-Specific Variability: VirB5 sequence divergence between Bartonella species may affect VirB3 interactions .

  • Functional Redundancy: Overlapping roles with VirB4/VirB11 in energy transmission require further clarification .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
virB3; BH13270; Type IV secretion system protein virB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)
Target Names
virB3
Target Protein Sequence
MNEDPLFLACTRPAMFAGVTMEAMAFNVMATSILFILTSGFTMIGLGIGLHFVLREITKH DHNQFRVLFAWLNTRGKQKNLNRWGGGSTSPLRLIRTYEELNR
Uniprot No.

Target Background

Function
The type IV secretion system VirB/VirD4 is a major virulence determinant responsible for subverting human endothelial cell (HEC) function. VirB-mediated changes in HEC include significant cytoskeletal rearrangements, a proinflammatory activation through the nuclear factor NF-kappa-B, inhibition of early and late apoptotic events, leading to increased cell survival, and, at high infection doses, a cytostatic or cytotoxic effect, which interferes with a potent VirB-independent mitogenic activity. These modifications in HEC require the T4S coupling protein VirD4 and at least one of the effector proteins BepA-G. VirB3 potentially contributes to stabilizing the pilus structure.
Database Links

KEGG: bhe:BH13270

STRING: 283166.BH13270

Protein Families
VirB3 family
Subcellular Location
Cell outer membrane; Single-pass membrane protein.

Q&A

What is the role of the VirB3 protein in Bartonella henselae's Type IV secretion system?

The VirB3 protein functions as a critical component of the B. henselae Type IV secretion system (T4SS), which forms a complex molecular machine that spans the bacterial cell envelope. Within this system, VirB3 is believed to contribute to the structural integrity of the secretion apparatus and assists in the translocation of effector molecules into host cells.

The VirB T4SS as a whole mediates several key virulence attributes during B. henselae's interaction with human endothelial cells, including:

  • Massive rearrangements of the actin cytoskeleton, resulting in the formation of bacterial aggregates and their internalization by the invasome structure

  • Nuclear factor kappaB-dependent proinflammatory activation, leading to cell adhesion molecule expression and chemokine secretion

  • Inhibition of apoptotic cell death, resulting in enhanced endothelial cell survival

What experimental animal models are suitable for studying VirB3 function in vivo?

Based on current research, immunocompromised mouse models appear more suitable than immunocompetent models for studying Bartonella henselae infection, which would be applicable to research on VirB3 function. A comparative study between Swiss Webster (SW, immunocompetent) and SCID/Beige (immunocompromised) mice demonstrated significant differences in infection establishment:

Mouse StrainInfection Success RateTissue Distribution Over Time
SW (immunocompetent)1/27 tissues PCR positive at day 10No progression by day 20 or 30
SCID/Beige (immunocompromised)7/9 mice infected with increasing tissue distribution2 positive tissues at day 10, 3 at day 20, 8 at day 30

The data indicate that SCID/Beige mice develop both acute and chronic infections with B. henselae, making them a more appropriate model for studying VirB3 and other virulence factors . When designing in vivo experiments to study VirB3 function, researchers should consider using immunocompromised mouse models to ensure sufficient bacterial persistence for meaningful analysis.

How is recombinant VirB3 protein typically expressed and purified for research use?

For recombinant expression of B. henselae VirB3, researchers typically employ bacterial expression systems with E. coli strains optimized for membrane protein expression. The methodological approach generally includes:

  • Gene cloning: The virB3 gene is amplified from B. henselae genomic DNA using PCR and cloned into an expression vector with an appropriate affinity tag (commonly His6 or GST).

  • Expression optimization: Since VirB3 is a membrane-associated protein, expression conditions must be carefully optimized, including:

    • Using E. coli strains designed for membrane protein expression (C41, C43, or Lemo21)

    • Inducing expression at lower temperatures (16-25°C)

    • Using reduced inducer concentrations to prevent formation of inclusion bodies

  • Purification strategy:

    • Membrane fraction isolation by ultracentrifugation

    • Solubilization using mild detergents (DDM, LDAO, or Triton X-100)

    • Affinity chromatography using the fusion tag

    • Size exclusion chromatography for final purification

Special consideration should be given to maintaining the native conformation of VirB3 during purification, as the protein's structure is crucial for functional studies and antibody production.

What methodologies are most effective for studying VirB3 protein interactions with other components of the Type IV secretion system?

Investigating VirB3 protein interactions within the T4SS complex requires sophisticated methodological approaches:

  • Co-immunoprecipitation (Co-IP) coupled with mass spectrometry:

    • Use anti-VirB3 antibodies to pull down protein complexes from B. henselae lysates

    • Identify interacting partners by LC-MS/MS

    • Validate interactions with reverse Co-IP using antibodies against identified partners

  • Bacterial two-hybrid systems:

    • Specially adapted for membrane protein interactions

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system has proven effective for studying T4SS protein interactions

  • Crosslinking mass spectrometry (XL-MS):

    • Apply protein crosslinkers to intact bacteria

    • Digest and analyze by mass spectrometry

    • Identify proximity relationships between VirB3 and other T4SS components

  • Fluorescence resonance energy transfer (FRET):

    • Generate fluorescently labeled VirB3 and potential interacting partners

    • Measure energy transfer as indication of protein-protein interactions

    • Particularly useful for studying dynamic interactions in living bacteria

  • Cryo-electron microscopy:

    • Visualize the entire T4SS complex at near-atomic resolution

    • Determine the structural position of VirB3 within the assembled machinery

When designing interaction studies, researchers should consider both stable and transient interactions, as the T4SS assembly is a dynamic process with proteins engaging in different interaction networks during secretion system assembly and effector translocation .

How can researchers differentiate between the effects of VirB3 mutation versus other VirB components when studying endothelial cell interactions?

Differentiating the specific contributions of VirB3 from other VirB components requires careful experimental design:

  • Genetic complementation analysis:

    • Generate a clean virB3 deletion mutant

    • Complement with wild-type virB3 on a plasmid

    • Create point mutations in conserved VirB3 domains

    • Assess each construct's ability to restore endothelial cell phenotypes

  • Domain-specific functional assays:

    • Design chimeric proteins with domains swapped between VirB3 and related proteins

    • Evaluate which domains are responsible for specific endothelial cell interactions

  • Temporal control of expression:

    • Use inducible promoters to control expression timing

    • Determine at which stage of infection VirB3 is required for specific cellular effects

  • Intracellular localization studies:

    • Track VirB3-GFP fusion proteins during B. henselae-endothelial cell interaction

    • Correlate VirB3 localization with specific cellular phenotypes

  • Comparative analysis framework:

    PhenotypeVirB3 MutantOther VirB MutantsExperimental Readout
    Actin cytoskeleton rearrangement?Known effectsImmunofluorescence microscopy
    NF-κB activation?Known effectsReporter gene assay
    Apoptosis inhibition?Known effectsTUNEL assay/Caspase activity
    Bacterial aggregation?Known effectsConfocal microscopy
    Invasome formation?Known effects3D cell reconstruction

What are the technical challenges in developing antibodies against recombinant VirB3, and how can they be overcome?

Developing antibodies against recombinant VirB3 presents several technical challenges:

  • Membrane protein nature:

    • VirB3 is hydrophobic with limited exposed epitopes

    • Solution: Use carefully selected peptide antigens from predicted exposed regions or use detergent-solubilized full-length protein

  • Conformational epitopes:

    • Native conformation may be crucial for antibody recognition

    • Solution: Purify VirB3 in nanodiscs or amphipols to maintain native membrane environment

  • Cross-reactivity concerns:

    • Homology with other bacterial proteins may lead to non-specific binding

    • Solution: Perform extensive antibody validation using knockout strains and preabsorption controls

  • Low immunogenicity:

    • Small membrane proteins often elicit poor immune responses

    • Solution: Use stronger adjuvants and carrier proteins; consider multiple immunization protocols

  • Methodological approach for antibody development:

    StepApproachOptimization Strategy
    Antigen preparationRecombinant expression with His-tagTest multiple detergents for optimal solubilization
    ImmunizationMultiple host species (rabbit, guinea pig)Extended immunization schedule with boosters
    Antibody screeningELISA, Western blot, immunofluorescenceInclude multiple positive and negative controls
    Specificity testingTest against ΔvirB3 mutant strainsPreabsorb antibodies with related proteins
    PurificationAffinity purification against immobilized antigenSelective elution conditions to preserve activity

When developing antibodies against VirB3, researchers should also consider using monoclonal approaches for greater specificity and reproducibility, especially for applications requiring discrimination between VirB3 and other T4SS components.

What are the best experimental conditions for studying VirB3-dependent host cell modulation in vitro?

To effectively study VirB3-dependent host cell modulation in vitro, researchers should consider the following experimental design elements:

  • Cell culture systems:

    • Human umbilical vein endothelial cells (HUVECs) are the gold standard for studying B. henselae vascular interactions

    • Primary dermal microvascular endothelial cells may better represent the in vivo situation for bacillary angiomatosis studies

    • Consider 3D culture systems to better recapitulate tissue architecture

  • Bacterial preparation:

    • Use mid-logarithmic phase bacteria for consistent virulence factor expression

    • Standardize bacterial doses using OD600 and confirm by CFU determination

    • Consider using GFP-expressing bacteria for visualization of host-pathogen interactions

  • Infection parameters:

    • Multiplicity of infection (MOI): Test a range (10-100)

    • Infection duration: Examine both early (4-24h) and late (24-72h) timepoints

    • Culture conditions: 5% CO2, 37°C, 95% humidity

  • Controls:

    • Wild-type B. henselae

    • Complete virB operon deletion mutant

    • Single deletion mutants of other virB components

    • Complemented virB3 mutant

  • Analysis timeline:

    TimepointCellular ProcessesAnalytical Methods
    0-2 hoursInitial attachmentAdhesion assays, confocal microscopy
    2-12 hoursInvasome formation initiationLive cell imaging, F-actin staining
    12-24 hoursNF-κB activation, chemokine secretionLuciferase reporters, cytokine arrays
    24-72 hoursApoptosis inhibition, proliferationTUNEL assay, BrdU incorporation

When designing these experiments, it's crucial to monitor both bacterial and host cell parameters simultaneously to establish causal relationships between VirB3 function and specific cellular responses .

What approaches can be used to resolve conflicting data regarding VirB3 function in different experimental systems?

When faced with conflicting data regarding VirB3 function across different experimental systems, researchers should implement a systematic troubleshooting and validation approach:

  • Standardize experimental conditions:

    • Create a detailed protocol repository with precise methodological parameters

    • Establish common positive and negative controls across laboratories

    • Use the same bacterial strains, host cell sources, and reagent batches when possible

  • Cross-validate with multiple methods:

    • Apply orthogonal techniques to measure the same biological outcome

    • Example: Validate protein-protein interactions using both Co-IP and FRET

    • Quantify cellular phenotypes with both microscopy and biochemical assays

  • Consider host-specific factors:

    • Compare results across different host cell types (primary vs. cell lines)

    • Evaluate the impact of host genetic background (human vs. mouse cells)

    • Assess the influence of host immunity status (immunocompetent vs. immunocompromised)

  • Analyze bacterial strain variations:

    • Compare laboratory-adapted strains with clinical isolates

    • Sequence verify the virB operon in all strains used

    • Consider potential compensatory mutations in laboratory strains

  • Framework for resolving conflicting data:

    Conflict TypeResolution ApproachExpected Outcome
    Method-dependent resultsBlind comparison by multiple investigatorsIdentification of method-specific artifacts
    Strain-specific differencesGenome sequence comparisonDiscovery of genetic modifiers
    Host cell type discrepanciesTranscriptome analysis of different host cellsIdentification of host factors influencing response
    Dosage-dependent effectsCareful titration experimentsEstablishment of dose-response relationships
    Temporal variationsDetailed time-course studiesResolution of kinetic differences

By systematically addressing these variables, researchers can resolve apparently conflicting data and develop a more comprehensive understanding of VirB3 function across different experimental contexts.

How should researchers interpret changes in VirB3 expression levels in relation to Bartonella henselae virulence in different host systems?

Interpreting changes in VirB3 expression levels requires a comprehensive analytical framework:

  • Expression level quantification methods:

    • RT-qPCR for mRNA quantification

    • Western blot with specific antibodies for protein levels

    • Reporter gene fusions (e.g., virB3-gfp) for live-cell monitoring

  • Correlation with virulence phenotypes:

    • Systematically measure multiple virulence parameters (adhesion, invasion, persistence)

    • Calculate correlation coefficients between expression levels and virulence metrics

    • Determine if relationships are linear or threshold-based

  • Host system considerations:

    • Compare results between reservoir hosts (cats) and incidental hosts (humans)

    • Evaluate expression in different cell types (erythrocytes vs. endothelial cells)

    • Consider differences between immunocompetent and immunocompromised models

  • Environmental trigger analysis:

    • Measure VirB3 expression under various environmental conditions

    • Identify specific host signals that modulate expression

    • Determine if expression changes are direct responses or compensatory mechanisms

  • Interpretation framework:

    Expression PatternVirulence CorrelationPossible Interpretation
    Increased expression, increased virulencePositive correlationDirect virulence determinant
    Increased expression, decreased virulenceNegative correlationPotential immunogenic factor or metabolic burden
    Differential expression across host typesHost-dependent correlationSpecialized adaptation to specific host niches
    Temporal expression changesTime-dependent correlationStage-specific virulence function

What statistical approaches are most appropriate for analyzing the effects of VirB3 mutations on bacterial persistence in animal models?

For analyzing the effects of VirB3 mutations on bacterial persistence in animal models, researchers should consider these statistical approaches:

  • Study design considerations:

    • Power analysis to determine appropriate sample sizes

    • Stratified randomization for animal assignment to groups

    • Blinded assessment of outcomes to prevent bias

  • Primary statistical methods:

    • Survival analysis (Kaplan-Meier) for time to bacterial clearance

    • Mixed-effects models for repeated measures of bacterial burden

    • Non-parametric tests (Mann-Whitney U) for comparing bacterial loads when data is not normally distributed

  • Specialized analyses for persistence data:

    • Area under the curve (AUC) analysis for bacterial load over time

    • Time-to-event analysis for detection of bacterial DNA in tissues

    • Proportion hazards models to identify factors affecting persistence

  • Multiple tissue analysis approach:

    • McNemar's test for comparing detection rates across tissues

    • Correction for multiple comparisons (Bonferroni or false discovery rate)

    • Principal component analysis to identify patterns of tissue distribution

  • Statistical framework for animal model data:

    Data TypeStatistical TestInterpretation Guidance
    Tissue distribution of bacterial DNATwo-way ANOVA with Tukey's multiple comparisonsAccounts for both time and tissue type effects
    Bacterial load quantificationLinear mixed modelsAccounts for repeated measures and individual variation
    Pathology scoresOrdinal regression or non-parametric testsAppropriate for categorical severity scores
    Time to clearanceCox proportional hazardsIdentifies factors influencing bacterial elimination rate
    Immune response correlationSpearman or Pearson correlationRelates immune parameters to bacterial persistence

When analyzing data from animal models, researchers should be mindful that different mouse strains (e.g., immunocompetent vs. immunocompromised) will show dramatically different patterns of bacterial persistence, as demonstrated in the SCID/Beige vs. Swiss Webster comparison, where significant differences in tissue distribution were observed (p = 0.0120) .

What are the emerging technologies that could advance our understanding of VirB3 structure and function?

Several cutting-edge technologies are poised to revolutionize our understanding of VirB3 structure and function:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution of membrane protein complexes

    • Potential to visualize VirB3 in the context of the assembled T4SS

    • Single-particle analysis to capture different conformational states

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, and molecular dynamics simulations

    • Cross-linking mass spectrometry to map protein interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) to visualize T4SS assembly

    • Correlative light and electron microscopy (CLEM) to link structure and function

    • Live-cell imaging with minimal fluorescent tags to track VirB3 dynamics

  • Genome editing technologies:

    • CRISPR-Cas9 for precise genetic manipulation of B. henselae

    • Creation of conditional knockouts to study essential T4SS components

    • Site-specific incorporation of unnatural amino acids for biophysical studies

  • Computational approaches:

    • AlphaFold2 and RoseTTAFold for protein structure prediction

    • Molecular dynamics simulations of VirB3 in membrane environments

    • Systems biology modeling of T4SS assembly and function

These emerging technologies will enable researchers to address fundamental questions about VirB3, including its precise structural arrangement within the T4SS complex, dynamic changes during effector translocation, and molecular interactions with both bacterial and host partners.

How might findings from VirB3 research inform the development of novel therapeutic approaches for Bartonella henselae infections?

Research on VirB3 and the T4SS offers several promising avenues for therapeutic development:

  • T4SS inhibitor development:

    • Structure-based design of small molecule inhibitors targeting VirB3

    • Peptide inhibitors mimicking critical interaction interfaces

    • Screening chemical libraries for compounds that disrupt T4SS assembly

  • Attenuated vaccine strategies:

    • Engineering B. henselae strains with modified virB3 for reduced virulence

    • Developing subunit vaccines incorporating VirB3 epitopes

    • Prime-boost strategies combining protein antigens with attenuated strains

  • Host-directed therapies:

    • Identifying and targeting host factors required for VirB T4SS function

    • Modulating endothelial cell signaling to prevent VirB-mediated effects

    • Developing compounds that enhance immune recognition of T4SS components

  • Diagnostic applications:

    • VirB3-specific antibodies for improved detection of B. henselae

    • Development of serology tests targeting T4SS antigens

    • PCR-based detection of virB3 sequence variants for epidemiological tracking

  • Therapeutic development framework:

    ApproachResearch FoundationClinical Application Potential
    T4SS inhibitorsVirB3 structural studiesTreatment of acute and chronic infections
    ImmunotherapeuticsVirB3 immunogenicity researchPrevention and therapy for at-risk populations
    BiomarkersVirB3 expression patternsImproved diagnostics and monitoring
    Host-targeting drugsVirB3-host interaction studiesAdjunctive therapy for complex infections
    Combination approachesSystems biology of T4SS functionManagement of difficult-to-treat infections

By focusing on the VirB T4SS as a major virulence determinant, researchers can develop targeted approaches that specifically inhibit bacterial pathogenesis while minimizing disruption to the host and commensal microbiota. This is particularly important for immunocompromised patients, who show increased susceptibility to persistent B. henselae infections, as demonstrated in mouse models .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.