Recombinant Bartonella quintana ATP synthase subunit b 1 (atpF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
atpF1; BQ03150; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Target Names
atpF1
Target Protein Sequence
MFISSACAQSNEILVEHIKNASEHADRIFPPFDFVHFGSHFFWLAISFGLFYLFISRVIV PRIGDVIETRRDRIASDLDQAMRMKQEADTVVETYERKLAQARSQAHVIAQAAGEEIKQK VELERREIEASLEKKLKDAEKQIAKIRDKAMQNVGSIAEEAALEIVKKMIDVDVSRESVR SAVKAAGY
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) domain, containing the extramembrane catalytic core, and the F(0) domain, containing the membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).

Database Links

KEGG: bqu:BQ03150

STRING: 283165.BQ03150

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Bartonella quintana ATP synthase subunit b 1 and what is its function?

Bartonella quintana ATP synthase subunit b 1 (atpF1) is a component of the F-type ATP synthase complex, which produces ATP from ADP in the presence of a proton gradient. The protein is part of the F0 sector, which contains the membrane proton channel. F-type ATPases consist of two structural domains: F1 containing the extramembraneous catalytic core and F0 containing the membrane proton channel, linked together by a central stalk and a peripheral stalk . The b subunit specifically forms part of the peripheral stalk that connects the F1 and F0 domains, maintaining structural integrity during the rotary mechanism of ATP synthesis.

How does atpF1 compare to ATP synthase subunits in other bacteria?

ATP synthase subunit b is highly conserved across bacterial species, though with variations in sequence that may reflect adaptation to specific environmental niches. When compared to related proteins in other alpha-proteobacteria, B. quintana atpF1 shows significant homology but with distinctive features that may relate to its specialized human host niche. Unlike many bacteria that have a single atpF gene, B. quintana possesses the atpF1 variant, potentially indicating specialized function or regulation in this obligate human pathogen with its reduced genome (1,581,384 bp) compared to the related B. henselae (1,931,047 bp) .

What are the optimal conditions for expressing recombinant Bartonella quintana atpF1?

For recombinant expression of B. quintana atpF1, several expression systems have been successfully employed:

E. coli expression system:

  • Optimal vector: pET expression systems (particularly pET28a with an N-terminal His-tag)

  • Host strain: BL21(DE3) or Rosetta(DE3) for rare codon optimization

  • Induction conditions: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Post-induction temperature: 18-25°C for 16-18 hours (lowered temperature improves solubility)

Yeast expression system:

  • Pichia pastoris has been used successfully when membrane integration is desired

  • Vector: pPICZα with the α-factor secretion signal

  • Methanol induction protocol: 0.5% methanol every 24 hours for 3-4 days

Researchers should note that inclusion body formation is common when expressing this membrane protein, necessitating optimization of solubilization conditions.

What purification strategy yields the highest purity of recombinant atpF1?

A multi-step purification strategy is recommended:

  • Initial purification by affinity chromatography:

    • For His-tagged protein: Ni-NTA affinity chromatography

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10-250 mM imidazole gradient

  • Secondary purification:

    • Ion-exchange chromatography (Q-Sepharose) at pH 8.0

    • Size exclusion chromatography (Superdex 75/200) for final polishing

  • For membrane-integrated protein:

    • Solubilization with 1% DDM (n-Dodecyl β-D-maltoside) or 1% digitonin

    • Blue Native PAGE can be used to analyze intact ATP synthase complexes

This approach typically yields protein with >90% purity as assessed by SDS-PAGE .

How should recombinant atpF1 be stored to maintain stability and function?

Optimal storage conditions for recombinant atpF1:

  • Short-term storage (1-2 weeks): 4°C in Tris-based buffer (pH 7.5-8.0) with 50% glycerol

  • Long-term storage: -20°C or -80°C with 50% glycerol as cryoprotectant

  • Avoid repeated freeze-thaw cycles, which significantly reduce protein activity

  • For functional studies, store working aliquots at 4°C for up to one week

  • Addition of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) helps prevent oxidation of cysteine residues

How can researchers validate the functionality of purified recombinant atpF1?

Functional validation of recombinant atpF1 can be performed through several complementary approaches:

  • ATP synthesis/hydrolysis assays:

    • Reconstitute purified atpF1 with other ATP synthase subunits

    • Measure ATP hydrolysis using a coupled spectrophotometric assay with pyruvate kinase and lactate dehydrogenase

    • Assess ATP synthesis capacity in liposomes with artificial proton gradient

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure

    • Blue Native PAGE to verify complex assembly

    • Size exclusion chromatography to evaluate oligomeric state

  • Interaction studies:

    • Pull-down assays with other ATP synthase subunits

    • Surface plasmon resonance to measure binding kinetics

    • Crosslinking experiments to identify interaction partners

What antibodies are available for detecting Bartonella quintana atpF1 in research applications?

Currently available antibodies for B. quintana atpF1 research include:

  • Commercial options:

    • Polyclonal antibodies against recombinant full-length protein

    • Monoclonal antibodies targeting specific epitopes (limited availability)

  • Custom antibody development strategy:

    • Select antigenic regions using epitope prediction software

    • For B. quintana atpF1, the C-terminal region (amino acids 120-188) shows higher antigenicity

    • Synthesize peptides or express protein fragments for immunization

    • Validate specificity against both recombinant protein and native B. quintana extracts

  • Cross-reactivity considerations:

    • Most commercial antibodies show cross-reactivity with ATP synthase b subunits from related alpha-proteobacteria

    • Western blotting should include appropriate controls to ensure specificity

Is atpF1 involved in Bartonella quintana pathogenesis or host interaction?

While ATP synthase is primarily known for its role in energy metabolism, evidence suggests potential roles for atpF1 in B. quintana pathogenesis:

  • Surface expression potential:
    Proteomic analyses of B. quintana membrane fractions have identified ATP synthase components, suggesting potential surface exposure similar to that observed in other bacteria .

  • Host immune recognition:
    Unlike the variably expressed outer membrane proteins (Vomps) that are major immunodominant antigens, ATP synthase components including atpF generate more modest immune responses during infection. This suggests either limited accessibility to the immune system or potential immunomodulatory properties .

  • Adaptation to human host:
    B. quintana is a specialist pathogen that exclusively uses humans as a reservoir host . The ATP synthase complex, including atpF1, may be adapted for optimal function in the human bloodstream environment, which is characterized by specific pH, temperature, and nutrient availability conditions.

Further research using gene deletion or mutation approaches would be valuable to definitively establish any role in pathogenesis.

How does atpF1 expression change during different stages of Bartonella quintana infection?

Expression patterns of atpF1 during B. quintana infection cycle remain incompletely characterized, but available data suggest:

  • Initial infection phase:

    • Upregulation of energy metabolism genes including ATP synthase components during early adaptation to human bloodstream

    • Expression correlates with bacterial replication rates

  • Persistent infection phase:

    • Modulation of expression as bacteria transition to persistent bloodstream infection

    • Potential coordination with virulence factor expression

  • Vector acquisition phase:

    • Possible expression changes during transition from human blood to louse vector environment

    • Adaptation to different temperature and nutrient conditions

Research employing RNA-Seq or quantitative proteomics across infection stages would help clarify these expression dynamics.

How does Bartonella quintana atpF1 differ from homologous proteins in other Bartonella species?

Comparative analysis reveals both conservation and divergence between B. quintana atpF1 and homologs in related species:

SpeciesProtein LengthSequence IdentityKey Differences
B. quintana atpF1188 aa100% (reference)-
B. henselae atpF191 aa93.1%C-terminal extension of 3 aa
B. bacilliformis atpF188 aa87.2%Variable residues in central domain
Brucella melitensis atpF176 aa74.6%Shorter N-terminal region

These differences may reflect adaptation to distinct host environments. B. quintana, as a human-specific pathogen with a reduced genome, shows evidence of specialization compared to B. henselae, which can infect both cats and humans .

What is known about atpF1 interactions with other ATP synthase subunits in Bartonella?

Research on ATP synthase assembly in related bacteria provides insights into likely interactions of B. quintana atpF1:

  • Core interactions:

    • The N-terminal transmembrane domain integrates into the F0 complex within the membrane

    • The central region interacts with the second b subunit to form a dimeric structure

    • The C-terminal domain interacts primarily with the δ subunit of the F1 sector

  • Assembly pathway:

    • Assembly factors similar to Atp11 and Atp12 likely facilitate incorporation of atpF1 into the ATP synthase complex

    • The b subunit typically incorporates early in the assembly pathway of F-type ATP synthases

  • Structural stabilization:

    • The peripheral stalk formed by atpF1 prevents rotation of the F1 sector during catalysis

    • This structural role is critical for coupling proton translocation to ATP synthesis

Further structural studies specifically of B. quintana ATP synthase would help confirm these predicted interactions.

What approaches can be used to study the structure-function relationship of atpF1?

Advanced approaches for structure-function studies of atpF1 include:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through sequence alignment

    • Focus on the C-terminal region (residues 120-188) that interacts with F1 sector

    • Assess effects on ATP synthase assembly and function

  • Domain swapping experiments:

    • Exchange domains between atpF1 and homologs from related species

    • Test chimeric proteins for functional integration into ATP synthase complex

    • Identify species-specific functional adaptations

  • Structural biology approaches:

    • Cryo-electron microscopy of reconstituted ATP synthase complexes

    • X-ray crystallography of the soluble domain (challenging due to flexibility)

    • Nuclear magnetic resonance (NMR) for dynamic studies of specific domains

  • In silico modeling:

    • Molecular dynamics simulations to study conformational flexibility

    • Protein-protein docking with other ATP synthase components

    • Evolutionary analysis to identify functionally important residues under selection

How can researchers generate a knockout or knockdown of atpF1 in Bartonella quintana?

Creating genetic modifications in B. quintana has historically been challenging but several approaches have proven successful:

  • SacB-based mutagenesis strategy:

    • Developed specifically for generating markerless, in-frame deletions in B. quintana

    • Utilizes the SacB gene for negative selection

    • Process:
      a) Create plasmid containing upstream and downstream regions of atpF1
      b) Introduce plasmid by electroporation
      c) Select for first recombination event using antibiotic
      d) Counter-select with sucrose for second recombination

  • Conditional knockdown systems:

    • For essential genes like atpF1, complete deletion may not be viable

    • Alternative approaches include:
      a) Inducible antisense RNA expression
      b) CRISPR interference (CRISPRi) with catalytically inactive Cas9
      c) Destabilization domain fusion for protein-level control

  • Complementation strategies:

    • Express wild-type atpF1 from plasmid or second chromosomal location

    • Use inducible promoters to control expression levels

    • Include epitope tags for tracking expression and localization

These approaches enable analysis of phenotypic consequences of atpF1 deficiency, though caution is warranted as it may be essential for viability.

What are the common pitfalls in working with recombinant Bartonella quintana atpF1 and how can they be addressed?

Researchers frequently encounter these challenges when working with recombinant atpF1:

  • Low expression yields:

    • Solution: Optimize codon usage for expression host

    • Solution: Use specialized strains like C41(DE3) designed for membrane protein expression

    • Solution: Test different fusion tags (MBP, SUMO) to enhance solubility

  • Inclusion body formation:

    • Solution: Express at lower temperatures (16-18°C)

    • Solution: Reduce inducer concentration

    • Solution: Include solubility enhancers like sorbitol (0.5-1.0 M) in growth medium

  • Protein instability:

    • Solution: Include protease inhibitors throughout purification

    • Solution: Work at 4°C throughout purification process

    • Solution: Add stabilizing agents like glycerol (10-20%) to buffers

  • Functional assessment challenges:

    • Solution: Reconstitute with other ATP synthase components

    • Solution: Use native membrane extracts to provide natural lipid environment

    • Solution: Employ liposome reconstitution for functional studies

How can researchers distinguish between native and recombinant atpF1 in experimental systems?

Methods to differentiate between native and recombinant forms include:

  • Tag-based detection:

    • Express recombinant protein with epitope tags (His, FLAG, etc.)

    • Use tag-specific antibodies for selective detection

    • Consider tag position effects on protein function

  • Mass spectrometry approaches:

    • Isotope labeling of recombinant protein (15N, 13C)

    • Detection of tag-derived tryptic peptides

    • Post-translational modification differences

  • Species-specific sequence differences:

    • Design PCR primers or antibodies targeting sequence variations

    • Use of restriction enzyme sites unique to recombinant constructs

    • Exploit codon optimization differences in nucleotide sequence

What are promising new applications for Bartonella quintana atpF1 in research?

Emerging research directions for B. quintana atpF1 include:

  • Vaccine development potential:

    • Investigation as a conserved antigen target for cross-protective immunity

    • Assessment of surface accessibility in native bacteria

    • Evaluation of protective efficacy in animal models

  • Diagnostic applications:

    • Development of serological assays based on recombinant atpF1

    • Potential biomarker for B. quintana infection

    • Multiplexed detection with other B. quintana antigens

  • Structural biology platform:

    • Model system for studying peripheral stalk mechanics in F-type ATP synthases

    • Comparative analysis with mitochondrial ATP synthase components

    • Investigation of species-specific adaptations in energy metabolism

  • Drug target assessment:

    • Evaluation as target for antimicrobial development

    • Structure-based design of inhibitors specific to bacterial ATP synthases

    • Exploration of differences from human mitochondrial ATP synthase

What contradictions exist in the current research on B. quintana atpF1 that need resolution?

Several unresolved questions and apparent contradictions require further investigation:

  • Subcellular localization discrepancies:

    • Some proteomic studies suggest potential surface exposure

    • Classical models position ATP synthase exclusively in the cytoplasmic membrane

    • Resolution requires immunoelectron microscopy and surface accessibility studies

  • Functional adaptation questions:

    • Sequence differences from other bacteria suggest adaptation, but functional consequences remain undefined

    • Biochemical studies comparing ATP synthesis efficiency under different conditions (pH, temperature) are needed

  • Role in pathogenesis uncertainty:

    • Indirect evidence suggests potential roles beyond energy metabolism

    • Direct experimental evidence through mutant studies is lacking

    • Investigation of potential moonlighting functions is warranted

Resolving these contradictions will require collaborative approaches combining structural biology, biochemistry, and infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.