Recombinant Bartonella quintana Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bartonella quintana Large-conductance Mechanosensitive Channel (MscL)

Recombinant Bartonella quintana Large-conductance Mechanosensitive Channel (MscL) refers to a lab-engineered form of the MscL protein derived from the bacteria Bartonella quintana . MscL is a mechanosensitive ion channel that responds to mechanical stimuli, such as changes in membrane tension, and plays a crucial role in bacterial survival under stress conditions . Bartonella quintana is a bacterium known to cause trench fever and is transmitted through body lice . Recombinant MscL is produced for research purposes, allowing scientists to study its structure, function, and potential applications .

Characteristics of Bartonella quintana

Bartonella quintana is a facultative, intracellular, Gram-negative bacterium . It measures about 0.3–0.5 μm in width and 1–1.7 μm in length . This bacterium can be grown on artificial media, though primary isolation may require up to 45 days of incubation . B. quintana resides in erythrocytes during bacteremia and shows a tropism for endothelial cells, leading to lesions .

Production of Recombinant MscL

The production of recombinant B. quintana MscL involves cloning the MscL gene from B. quintana into an expression vector . This vector is then introduced into a host organism, such as E. coli, where the MscL protein is produced . The recombinant protein is then purified using techniques like affinity chromatography .

Structure and Function of MscL

MscL proteins are typically composed of several subunits that form a channel through the cell membrane. These channels open in response to membrane tension, allowing ions to flow across the membrane, which helps bacteria to maintain osmotic balance and survive under stressful conditions .

Research Applications

Recombinant B. quintana MscL is used in various research areas, including:

  • Structural Biology: Determining the high-resolution structure of MscL using X-ray crystallography or cryo-electron microscopy to understand its gating mechanism.

  • Biophysics: Studying the channel's electrophysiological properties and response to different mechanical stimuli.

  • Drug Discovery: Identifying compounds that can modulate MscL activity, potentially leading to new antibacterial agents.

Diagnostic Utility

Recombinant proteins from Bartonella species, including the 17-kDa protein and Pap31, have been used for diagnostic purposes . These recombinant proteins can be used in enzyme-linked immunosorbent assays (ELISA) to detect antibodies in patient sera, aiding in the diagnosis of Bartonella infections .

Detection Methods for Bartonella quintana

Various methods are employed to detect B. quintana, including:

  • Serologic Tests: Indirect immunofluorescence assays are commonly used, with IgG titers >1:50 indicating infection .

  • Culture: B. quintana can be cultured on solid media or in blood culture broths, with subculturing enhancing isolation .

  • Molecular Biology: PCR assays can detect Bartonella DNA in blood and tissues, with various targets used for species-level identification .

  • Immunohistochemistry: This method is used to detect B. quintana in tissues, such as heart valves and skin biopsies .

Table: Comparison of Bartonella Detection Methods

MethodDescriptionAdvantagesDisadvantages
Serologic TestsMeasures antibodies against Bartonella antigens using indirect immunofluorescence.Widely used, relatively simple.Cross-reactions with other organisms, variability in titers.
CultureIsolates B. quintana from blood or tissue samples.Confirms presence of viable bacteria.Slow, requires specialized media, may take up to 45 days for primary isolation.
Molecular Biology (PCR)Detects Bartonella DNA in samples using PCR assays.High sensitivity and specificity, can be used on various tissue types.Requires specific primers, may not differentiate between viable and dead bacteria.
ImmunohistochemistryDetects B. quintana in tissue samples using antibodies.Visualizes bacteria in tissue, useful for localized infections.Requires tissue samples, may not be as sensitive as PCR.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; BQ02880; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNMIDLAIGVIIGGAFGGLVNSIVNDILMPIIGFITGGIDFSNMFIQLA GEKQATLSAAKTAGATISYGNFITLLINFLIIAWVLFLFVKGMNKIRRKQEKEESSKKMS LEEQLLSEIRDLLAKKK
Uniprot No.

Target Background

Function

This channel opens in response to membrane stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure changes.

Database Links

KEGG: bqu:BQ02880

STRING: 283165.BQ02880

Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Bartonella quintana and why is its mscL protein significant for research?

Bartonella quintana is a gram-negative bacterium that causes trench fever and is transmitted by human body lice (Pediculus humanus var. corporis) . It is historically significant for causing disease during World War I but has reemerged among homeless populations in cities across the United States and Europe .

The mechanosensitive channel of large conductance (mscL) in B. quintana is significant because mechanosensitive channels act as "emergency relief valves" that protect bacteria from lysis during acute osmotic downshock . This protein represents an important bacterial adaptation mechanism and potential therapeutic target. Understanding its structure and function contributes to our knowledge of bacterial survival mechanisms and host-pathogen interactions.

How do researchers properly store and handle recombinant B. quintana mscL protein?

For optimal stability and activity, researchers should:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • After reconstitution, add 5-50% glycerol (with 50% being recommended as the final concentration) and aliquot for long-term storage

  • Avoid repeated freeze-thaw cycles as they may decrease protein stability and activity

  • Store working aliquots at 4°C for up to one week

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

This handling protocol ensures maximum retention of the protein's structural integrity and biological activity for experimental applications.

What expression systems are most effective for producing recombinant B. quintana mscL protein?

Based on current research protocols, E. coli expression systems have proven most effective for producing recombinant B. quintana mscL protein . The methodology typically involves:

  • Cloning the mscL gene into an appropriate expression vector containing a His-tag sequence

  • Transforming the recombinant plasmid into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Purifying the expressed protein using nickel-agarose column chromatography

  • Confirming protein integrity through SDS-PAGE analysis

Similar approaches have been successful with other Bartonella proteins, such as the B. henselae 17-kDa protein, which yielded approximately 2.9 mg of purified protein from 100 mL of bacterial culture .

What purification methods yield the highest purity of recombinant B. quintana mscL protein?

To achieve high purity (>90%) recombinant B. quintana mscL protein, researchers should implement:

  • Immobilized metal affinity chromatography (IMAC) using nickel-agarose columns, which takes advantage of the His-tag incorporated into the recombinant protein

  • Buffer optimization, typically using Tris-based buffers with 6% trehalose at pH 8.0

  • Proper elution strategies with imidazole gradients

  • Additional purification steps such as ion exchange chromatography or size exclusion chromatography if higher purity is required

  • Quality control through SDS-PAGE to verify purity exceeds 90%

This multi-step purification protocol enables researchers to obtain protein preparations suitable for structural studies, enzymatic assays, and immunological investigations.

How can researchers utilize recombinant B. quintana mscL protein to study mechanosensitive channel dynamics?

Advanced researchers can implement several approaches to study mechanosensitive channel dynamics using recombinant B. quintana mscL:

  • Liposome reconstitution assays: Incorporate purified mscL into artificial liposomes to study channel function in response to membrane tension changes, similar to studies performed with S. aureus MscL-CΔ26

  • Patch-clamp electrophysiology: Measure channel conductance and gating properties in response to membrane tension

  • Site-directed mutagenesis: Create strategic mutations in the mscL sequence to identify key residues involved in channel gating

  • Structural studies: Use techniques like X-ray crystallography or cryo-electron microscopy to characterize different conformational states (closed, expanded intermediate, and open), as has been done with MscL from other bacterial species

  • Molecular dynamics simulations: Model the behavior of the channel under different membrane tension conditions

These methodologies can help elucidate the specific mechanisms of how B. quintana mscL responds to mechanical stress and contributes to bacterial survival under osmotic pressure.

What is known about the functional differences between mscL proteins from different Bartonella species?

  • Conducting comparative sequence analyses of mscL proteins from B. quintana, B. henselae, and other Bartonella species to identify conserved and variable domains

  • Expressing and purifying recombinant mscL proteins from different Bartonella species using identical protocols

  • Performing functional assays to compare channel properties, such as:

    • Threshold for activation

    • Conductance characteristics

    • Inactivation kinetics

    • Response to different osmotic challenges

Based on research with other bacterial species, variations in the periplasmic loop of MscL can influence channel kinetics and mechanosensitivity , suggesting this region may be of particular interest when comparing Bartonella mscL proteins.

How does the structure of B. quintana mscL compare with mechanosensitive channels from other bacterial species?

While the specific crystal structure of B. quintana mscL has not been reported in the provided research, comparative analysis can be performed based on knowledge of related mechanosensitive channels:

  • The structure of MscL from Mycobacterium tuberculosis (TbMscL) represents a closed-state or nonconducting conformation, forming a pentameric channel

  • The structure of a truncation mutant of MscL from Staphylococcus aureus (SaMscL-CΔ26) reveals a tetrameric channel with transmembrane helices tilted away from the membrane normal, likely representing a nonconductive but partially expanded intermediate state

To fully characterize B. quintana mscL structure:

  • Researchers should express sufficient quantities of the recombinant protein for crystallization trials

  • Compare the secondary structure elements with those of TbMscL and SaMscL

  • Analyze whether B. quintana mscL forms tetrameric or pentameric channels

  • Examine the conformational states using techniques such as cryo-electron microscopy

Understanding these structural properties would provide insights into the specific mechanisms of B. quintana adaptation to osmotic stress.

How does B. quintana mscL contribute to bacterial pathogenesis and survival within human hosts?

The role of mscL in B. quintana pathogenesis can be investigated through several methodological approaches:

  • Gene knockout studies: Create mscL-deficient B. quintana strains and assess their viability under osmotic stress conditions and ability to establish infection

  • Expression analysis: Measure mscL expression levels during different stages of infection or under various environmental stresses

  • Host cell interaction studies: Evaluate whether mscL affects B. quintana's ability to adhere to or invade host cells, similar to research on outer membrane proteins such as Vomps (VompA, VompB, VompC)

  • Animal infection models: Compare virulence of wild-type versus mscL-mutant B. quintana strains

Research on related Bartonella proteins has shown that variably expressed outer membrane proteins (Vomps) mediate collagen binding and autoaggregation of B. quintana . While direct evidence for mscL's role in pathogenesis is limited, mechanosensitive channels are generally crucial for bacterial adaptation to environmental changes encountered during host infection.

Can recombinant B. quintana mscL be utilized in diagnostic or vaccine development research?

Approaches for using recombinant B. quintana mscL in diagnostic or vaccine research include:

  • Serological diagnostics: Evaluate the immunoreactivity of recombinant mscL with sera from patients infected with B. quintana to determine its potential as a diagnostic antigen

  • Cross-reactivity studies: Assess whether antibodies against B. quintana mscL cross-react with other Bartonella species, similar to studies showing that B. henselae 17-kDa protein is recognized by serum from patients infected with both B. henselae and B. quintana

  • Epitope mapping: Identify immunodominant regions that might serve as candidates for subunit vaccines

  • Immunization trials: Test whether recombinant mscL can elicit protective immunity in animal models

For diagnostic development, the sensitivity and specificity must be rigorously evaluated. For comparison, the IgG enzyme-linked immunosorbent assay (ELISA) using the recombinant B. henselae 17-kDa protein showed 71.1% sensitivity and 93.0% specificity relative to immunofluorescent antibody assay testing .

What are the major technical challenges in studying B. quintana mscL function and how can they be addressed?

Researchers face several challenges when studying B. quintana mscL:

  • Difficulty in culturing B. quintana: Address by using recombinant expression systems rather than native protein purification

  • Protein stability issues: Develop optimized buffer conditions and storage protocols to maintain functional integrity

  • Functional reconstitution challenges: Establish reproducible protocols for incorporating mscL into liposomes for functional studies

  • Structural characterization limitations: Combine multiple approaches (X-ray crystallography, cryo-EM, molecular dynamics) to overcome difficulties in capturing different conformational states

  • Limited animal models: Develop appropriate infection models that recapitulate human B. quintana infection

Each challenge requires specific methodological approaches. For instance, protein stability issues can be addressed through systematic buffer optimization and the addition of stabilizing agents like trehalose or glycerol during storage .

How might research on B. quintana mscL contribute to therapeutic developments for Bartonella infections?

Future research directions for therapeutic applications include:

  • Channel inhibitor development: Identify compounds that specifically block mscL function, potentially disrupting B. quintana's ability to respond to osmotic stress

  • Structure-based drug design: Use the three-dimensional structure of mscL to design small molecules that interfere with channel gating

  • Combination therapy approaches: Test whether mscL inhibitors might synergize with conventional antibiotics by preventing bacterial adaptation to stress

  • Biomarker development: Assess whether mscL expression levels correlate with disease severity or prognosis in patients with B. quintana infections

These approaches are particularly relevant given the increasing incidence of B. quintana infections in vulnerable populations and the association with severe outcomes such as endocarditis. A recent study found that B. quintana was a common cause of Bartonella serologic positivity among adults in Manitoba from 2010 to 2020, with endocarditis cases resulting in systemic embolization . Additionally, 19% of systematic review-identified cases with B. quintana disease resulted in death, all attributed to endocarditis .

How do different B. quintana strains vary in their mscL expression and function?

To investigate strain variation in mscL expression and function, researchers should:

  • Sequence the mscL gene from multiple clinical and laboratory B. quintana isolates to identify polymorphisms

  • Perform quantitative PCR to measure mscL expression levels across different strains under standardized conditions

  • Express and purify recombinant mscL from different strains to compare functional properties

  • Evaluate whether strain-specific variations correlate with clinical outcomes or epidemiological patterns

This approach parallels research on other B. quintana proteins, such as Vomps, where strain-specific differences have been observed. For example, while genes for VompA, VompB, VompC, and VompD were identified in the genome sequence of B. quintana JK-31, only VompA, VompB, and VompC were found to be expressed on the surface, and a spontaneous variant (B. quintana 2-D70) does not express any Vomp .

What insights from structural studies of other bacterial mechanosensitive channels can be applied to B. quintana mscL research?

Based on structural studies of related mechanosensitive channels, researchers can apply several insights:

  • The carboxy-terminal helix bundle likely stabilizes the channel in the closed state and restrains the transmembrane helices from tilting into expanded conformations

  • Channel gating may involve a two-step helix-pivoting mechanism, as observed in S. aureus MscL :

    • First step: Tilting of transmembrane helices away from the membrane normal

    • Second step: Counterclockwise rotation of helix pairs to expand the pore diameter

  • Highly conserved glycine residues (such as Gly 48 in S. aureus MscL) may serve as pivot points for the outward swinging of transmembrane helix pairs

  • The periplasmic loop likely provides flexibility for substantial relative movements of transmembrane helices while defining the steric limit of channel expansion

By applying these insights to B. quintana mscL research, investigators can develop targeted hypotheses about structure-function relationships specific to this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.