Recombinant Bartonella quintana Lipoprotein signal peptidase (lspA)

Basic Research Questions

• What is Bartonella quintana Lipoprotein signal peptidase (lspA) and what is its role in bacterial physiology?

  Lipoprotein signal peptidase (LspA) from Bartonella quintana is an aspartyl protease that performs the second critical step in the bacterial lipoprotein processing pathway. It specifically cleaves the transmembrane helix signal peptide of lipoproteins after lipidation by phosphatidylglycerol-prolipoprotein diacylglyceryl transferase (Lgt) .

  The enzyme is essential for proper lipoprotein maturation, which affects multiple bacterial functions including signal transduction, stress sensing, virulence, cell division, nutrient uptake, and adhesion . In the Bartonella genus, properly processed lipoproteins are vital for establishing infection in both human and insect vector environments.

  The protein is encoded by the lspA gene (Ordered Locus Name: BQ00090) in B. quintana and has alternative designations including prolipoprotein signal peptidase, signal peptidase II, and SPase II .

• What is the molecular structure and key characteristics of B. quintana LspA?

  B. quintana LspA is a 167-amino acid membrane protein with the following characteristics:

  • Contains a catalytic dyad typical of aspartyl proteases

  • Possesses a full amino acid sequence of: MTRKSFSFFLGLILTVGIDQTVKYWIMHNMLLGTEIPLLPFLSLYHVRNSGIAFSFFSSSHWGLIALTLIILIFLLWLWKNTEYNKFLSRFGLTLIIGGAIGNLIDRICFYYVIDYILFYIDDIFYFAVFNLADTFITLGVIAIVTEELRIWIKEKRHSKRTFSR

  • Features multiple transmembrane domains that anchor it in the bacterial membrane

  • Has a periplasmic helix that fluctuates on the nanosecond timescale

  • Contains highly conserved residues surrounding the active site

  Structural studies of LspA from other bacterial species suggest that B. quintana LspA likely samples three main conformational states: closed, intermediate, and open, with each state serving different functional roles in the catalytic cycle .

• How does B. quintana LspA function within the bacterial lipoprotein processing pathway?

  The lipoprotein processing pathway in Gram-negative bacteria involves three sequential enzymatic steps:

  Step	Enzyme	Function
  1	Lgt (Phosphatidylglycerol-prolipoprotein diacylglyceryl transferase)	Diacylation of the substrate cysteine
  2	LspA (Lipoprotein signal peptidase)	Cleavage of the signal peptide from the lipidated prolipoprotein
  3	Lnt (Apolipoprotein N-acyltransferase)	N-acylation of the lipid modification (absent in Gram-positive bacteria)

  LspA specifically recognizes the "lipobox" motif in prolipoproteins after they have been lipidated by Lgt. The enzyme then cleaves the signal peptide immediately before the modified cysteine residue, allowing for proper folding and localization of the mature lipoprotein . This processing is critical for bacterial envelope integrity and various virulence mechanisms.

Intermediate Research Questions

• What expression systems and purification methods are recommended for producing recombinant B. quintana LspA?

  Based on successful approaches with other bacterial LspA proteins, the following methodology is recommended:

  Expression System:

  • In vivo expression in E. coli host strains optimized for membrane proteins (C41, C43, or BL21(DE3) with pLysS)

  • Use of vectors with tightly controlled promoters (e.g., pET series) to minimize toxicity

  • Inclusion of a hexahistidine tag for purification purposes

  Purification Protocol:

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents such as LMNG (lauryl maltose neopentyl glycol) or DDM (n-dodecyl-β-D-maltopyranoside)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for final purification step

  Storage:

  • Store at -20°C for standard use, or -80°C for extended storage

  • Use 50% glycerol in Tris-based buffer optimized for protein stability

  • Avoid repeated freeze-thaw cycles; maintain working aliquots at 4°C for up to one week

• What assays are available for measuring B. quintana LspA activity and inhibition?

  Several complementary assays can be employed to measure LspA activity and inhibition:

  Gel-Shift Assay:

  • Uses a recombinant prolipoprotein substrate (e.g., proICP)

  • Activity detected by SDS-PAGE as a mobility shift between uncleaved and cleaved forms

  • Reaction typically contains ~12 μM substrate, 250 μM phospholipids, and 0.5 μM LspA

  • Conditions: 37°C, pH 7.5, with detergent (e.g., LMNG) to maintain enzyme solubility

  FRET-Based Assay:

  • Utilizes synthetic fluorescent lipopeptide substrates

  • Enables real-time kinetic measurements

  • Typical enzyme concentration: 0.1-0.3 μM

  • Can determine kinetic parameters (Km, Vmax) and inhibitor constants (IC50)

  Inhibition Studies:

  • Natural inhibitors like globomycin and myxovirescin can be used as controls

  • IC50 determination requires multiple inhibitor concentrations (0-3.2 mM range)

  • Tight-binding inhibition analysis may be necessary for potent inhibitors

• How does B. quintana LspA compare to orthologs from other bacterial species?

  Comparative analysis of LspA proteins shows both similarities and differences:

  Species	Size (aa)	Key Differences	Enzymatic Properties	Inhibitor Sensitivity
  B. quintana	167	Adapted to dual host environments	Not directly measured	Unknown
  S. aureus	163	Gram-positive bacterial adaptation	Km ~47 μM, Vmax ~2.5 nmol/(mg·min)	IC50 to globomycin: 171 μM (with lipoprotein substrate)
  P. aeruginosa	~164	Gram-negative adaptation	Km ~10 μM, Vmax ~107 nmol/(mg·min)	IC50 to globomycin: 0.64 μM (with lipoprotein substrate)

  The core architecture and catalytic mechanism appear conserved across species, but B. quintana LspA likely has specific adaptations related to its unique lifecycle involving human hosts and body louse vectors. These could include temperature responsiveness and specialized substrate recognition patterns .

• What is the relationship between LspA and B. quintana pathogenesis?

  LspA plays a crucial role in B. quintana pathogenesis through multiple mechanisms:

  • Processing of lipoproteins essential for bacterial survival in diverse host environments

  • Contribution to cell envelope integrity required for persistence in the bloodstream

  • Potential regulation by environmental signals encountered during infection cycles

  • Processing of specific virulence-associated lipoproteins including:

    • Hemin binding proteins (HbpA-E), which are critical for acquiring hemin in both human and insect vector environments

    • Outer membrane proteins with roles in adhesion and host cell interaction

  The lspA gene in B. quintana may be regulated along with other virulence factors through the Irr transcription factor, which responds to environmental signals including temperature and hemin availability . This allows the bacterium to adjust lipoprotein processing based on its location within the infection cycle.

Advanced Research Questions

• What conformational dynamics does B. quintana LspA exhibit, and how do they relate to substrate recognition and catalysis?

  Based on structural and functional studies of LspA from model organisms, B. quintana LspA likely undergoes significant conformational changes during its catalytic cycle:

  Conformational States:

  • Closed state: The dominant conformation in the apo state, where the periplasmic helix occludes the charged active site from the lipid bilayer

  • Intermediate state: An in-between conformation that may be involved in substrate binding or product release

  • Open state: Observed when inhibitors bind, allowing substrate access to the active site

  Functional Implications:

  • The flexibility of the periplasmic helix adapts to accommodate diverse lipoprotein substrates

  • Conformational changes are likely regulated by the membrane environment and substrate binding

  • These dynamics explain how LspA can process structurally diverse lipoproteins

  Experimental Approaches:

  • Molecular dynamics (MD) simulations can predict conformational changes in different conditions

  • Electron paramagnetic resonance (EPR) spectroscopy with spin-labeled variants can experimentally validate these predictions

  • X-ray crystallography of inhibitor-bound states provides static snapshots of specific conformations

• What are the molecular mechanisms of inhibitor binding to LspA, and how can this inform novel antibiotic development?

  Inhibitor binding studies with LspA from model organisms reveal important insights:

  Mechanism of Action:

  • Natural inhibitors like globomycin and myxovirescin function as tetrahedral intermediate analogs

  • Despite different molecular structures, these inhibitors bind identically to the active site

  • They contain a common 19-atom motif that mimics part of the lipoprotein substrate

  Structural Requirements:

  • Inhibitors must access the active site through the lipid bilayer

  • They must form specific interactions with the catalytic dyad residues

  • The β-cradle structure of LspA accommodates inhibitors by opening the periplasmic helix

  Drug Development Strategies:

  • Incorporate the conserved 19-atom motif into novel scaffolds

  • Design molecules with appropriate pharmacokinetic properties for clinical use

  • Target the conformational flexibility of LspA to lock it in inactive states

  • Develop analogs resistant to bacterial efflux mechanisms

  The high conservation of LspA across bacterial species suggests that broad-spectrum antibiotics targeting this enzyme are feasible, though species-specific differences in sensitivity must be considered .

• How can site-directed mutagenesis be used to investigate B. quintana LspA function and substrate specificity?

  Site-directed mutagenesis is a powerful approach for understanding LspA structure-function relationships:

  Key Targets for Mutation:

  • Catalytic dyad residues (likely conserved aspartate residues)

  • Residues in the periplasmic helix that regulate conformational dynamics

  • Substrate-binding pocket residues that determine specificity

  • Transmembrane interfaces that interact with the lipid bilayer

  Experimental Design:

  • Generate point mutations using established PCR-based methods

  • Express mutant proteins in E. coli expression systems

  • Assess enzyme activity using gel-shift and FRET assays

  • Compare kinetic parameters (Km, kcat) between wild-type and mutant enzymes

  Validation in B. quintana:

  • B. quintana genetic manipulation has been demonstrated using a suicide vector strategy

  • Transformation-competent strains can be prepared by electroporation

  • Complementation studies can confirm in vivo function of mutant proteins

  An example workflow successfully implemented for other B. quintana genes involves:

  1. Generating a transformation-competent strain using the pEST replicon

  2. Curing this strain of pEST through serial passages

  3. Transforming with a suicide vector containing the mutated gene

  4. Selecting transformants and verifying the mutation

• What is the relationship between B. quintana LspA and the organism's unique ability to adapt to different host environments?

  B. quintana must adapt to dramatically different environments during its lifecycle:

  Environmental Adaptation Mechanisms:

  • Temperature shifts between human host (37°C) and body louse (30°C)

  • Oxygen concentration differences between bloodstream (5%) and louse gut (variable)

  • Hemin availability variations between environments

  LspA's Role in Adaptation:

  • LspA processes lipoproteins whose expression is differentially regulated based on environmental signals

  • The hemin binding protein (Hbp) family, which requires LspA processing, shows environment-specific expression patterns:

    • Subgroup I (HbpC and HbpB) dominates in louse environment (high heme)

    • Subgroup II (HbpA, HbpD, and HbpE) is preferred in human environment (low heme)

  Regulatory Network:

  • LspA activity may be indirectly regulated by the iron response regulator (Irr)

  • Temperature-responsive elements may influence LspA expression or activity

  • Oxygen levels affect the expression of LspA substrates

  Research Approaches:

  • Quantitative RT-PCR to measure lspA expression under various environmental conditions

  • Proteomic analysis to identify differentially processed lipoproteins

  • Infection models mimicking both human and louse environments to assess LspA's role in adaptation

• How does LspA function in the context of B. quintana's unique LPS structure and TLR4 antagonism?

  B. quintana possesses a unique lipopolysaccharide (LPS) with distinct immunomodulatory properties:

  B. quintana LPS Characteristics:

  • Functions as a potent TLR4 antagonist, blocking cytokine production induced by E. coli LPS

  • Contains a unique structure with lipid A having long fatty acid side chains

  • Lacks an O-chain polysaccharide, classifying it as a lipooligosaccharide (LOS)

  • Maintains antagonistic activity even in the presence of polymyxin B

  LspA's Potential Role:

  • May process lipoproteins involved in LPS/LOS biosynthesis or modification

  • Could affect outer membrane composition and organization, influencing LPS presentation

  • Might process lipoproteins that work in concert with LPS to modulate host immune responses

  Research Strategies:

  • Comparative lipidomics of wild-type vs. LspA-depleted B. quintana

  • Analysis of outer membrane protein composition dependent on LspA activity

  • Investigation of potential crosstalk between lipoprotein and LPS biosynthetic pathways

  • Assessment of immune evasion capabilities in LspA-modified strains

  Understanding this relationship could reveal how B. quintana coordinates multiple virulence mechanisms to establish persistent infection while evading host immune responses.

Methodological Questions

• What are the optimal conditions for storing and handling recombinant B. quintana LspA to maintain activity?

  Proper storage and handling of recombinant LspA is critical for maintaining enzymatic activity:

  Storage Recommendations:

  • Store primary stock at -20°C for routine use or -80°C for extended storage

  • Use a storage buffer containing Tris-HCl (pH 7.5), 50% glycerol, and appropriate detergent

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  Handling Procedures:

  • Maintain the protein in detergent above its critical micelle concentration at all times

  • Include reducing agents (e.g., DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Perform activity assays within 24-48 hours of thawing for optimal results

  • Control temperature during assays (typically 37°C) to reflect physiological conditions

  Activity Preservation:

  • Addition of phospholipids (e.g., DOPG) at 250 μM can help maintain the native-like membrane environment

  • Glycerol at 10-15% can be included in reaction buffers to stabilize the protein

  • Avoid metal chelators that might affect the active site

  • Maintain pH between 7.0-7.5 for optimal activity

• What experimental approaches can be used to study the role of LspA in B. quintana pathogenesis in vivo?

  Investigating LspA's role in pathogenesis requires specialized approaches:

  Animal Models:

  • Rhesus macaques can serve as an experimental model for B. quintana infection

  • Body louse (Pediculus humanus corporis) can be used to study the arthropod stage

  • Sequential infection of both models can recapitulate the complete life cycle

  Genetic Manipulation Strategies:

  • Conditional knockout systems to study essential genes like lspA

  • Site-directed mutagenesis to create catalytically inactive variants

  • Complementation studies with wild-type and mutant alleles

  Infection Parameters to Monitor:

  • Bacteremia levels and persistence

  • Colonization of specific tissues

  • Host immune response profiles

  • Bacterial gene expression changes during infection

  Advanced Techniques:

  • RNA-seq to identify LspA-dependent gene expression changes

  • Transposon sequencing (Tn-seq) to identify genetic interactions with lspA

  • Imaging mass spectrometry to localize processed lipoproteins in infected tissues

  • Single-cell analysis to detect heterogeneity in LspA activity during infection

• How can researchers develop and validate specific antibodies against B. quintana LspA for research applications?

  Developing specific antibodies requires careful design and validation:

  Antigen Design Strategies:

  • Use recombinant full-length LspA purified under native conditions

  • Generate synthetic peptides corresponding to exposed epitopes (likely in periplasmic regions)

  • Create fusion proteins with carrier molecules to enhance immunogenicity

  Production Methods:

  • Polyclonal antibodies: Immunize rabbits or guinea pigs with purified antigen

  • Monoclonal antibodies: Screen hybridoma clones for specificity and sensitivity

  • Recombinant antibodies: Generate single-chain variable fragments (scFvs) through phage display

  Validation Protocol:

  • Western blot analysis using recombinant protein and native B. quintana lysates

  • Immunoprecipitation to confirm antibody-antigen interaction

  • Immunofluorescence microscopy to verify cellular localization

  • Cross-reactivity testing against related bacterial species

  Applications:

  • Quantification of LspA expression under different environmental conditions

  • Localization studies in B. quintana cells

  • Co-immunoprecipitation to identify interacting proteins

  • Immunohistochemistry to detect LspA in infected tissues