Recombinant Bartonella quintana NADH-quinone oxidoreductase subunit K (nuoK)

What is Bartonella quintana NADH-quinone oxidoreductase subunit K (nuoK) and what is its significance in research?

NADH-quinone oxidoreductase subunit K (nuoK) is a membrane protein component of the NADH dehydrogenase I complex (also known as NDH-1) in Bartonella quintana. This protein is encoded by the nuoK gene and plays a crucial role in the electron transport chain and energy metabolism of this pathogen. The full-length protein consists of 102 amino acids with a sequence of MHIDITHYLIVSALIFTIGIAGIFLNRKNVIIILMSIELILLSVNLNFVAFSAFFQDLVGQIFALFILTVAAAEAAIGLAILVVFFRNCGSIAVEDVNVMKG .

Bartonella quintana is a facultative intracellular gram-negative bacterium that causes trench fever and is associated with serious conditions including endocarditis and bacillary angiomatosis . The study of nuoK contributes to our understanding of B. quintana's metabolic processes and potentially its virulence mechanisms, making it a valuable target for both basic microbiology research and applied studies in infectious disease.

What is the structural composition and functional role of nuoK in Bartonella quintana?

The nuoK protein in B. quintana functions as part of the NADH-quinone oxidoreductase complex, which catalyzes the transfer of electrons from NADH to quinones in the respiratory chain (EC 1.6.99.5) . Structurally, nuoK is a small, hydrophobic membrane protein that contains transmembrane domains that anchor it within the bacterial membrane.

Based on the amino acid sequence and homology to similar proteins, nuoK likely contains multiple transmembrane helices that form part of the proton-translocating mechanism of the respiratory complex. The specific structural features include:

• Hydrophobic residues that facilitate membrane integration

• Conserved residues involved in proton translocation

• Interaction domains with other subunits of the NADH dehydrogenase complex

These structural characteristics enable nuoK to participate in energy conservation processes essential for bacterial survival and metabolism, potentially influencing the pathogen's ability to persist in human hosts.

What expression systems are most effective for recombinant nuoK production?

The most documented expression system for recombinant B. quintana nuoK is E. coli . This bacterial expression system offers several advantages:

When expressing recombinant nuoK, researchers typically add N-terminal or C-terminal tags (such as His-tag) to facilitate purification . The recombinant protein can then be purified using affinity chromatography, followed by size exclusion chromatography if higher purity is required.

For optimal expression, researchers should consider:

• Codon optimization for the expression host

• Use of specialized E. coli strains designed for membrane protein expression

• Induction conditions (temperature, inducer concentration, and timing)

• Membrane extraction and solubilization methods appropriate for integral membrane proteins

What are the optimal storage and handling conditions for recombinant nuoK?

Based on documented protocols, recombinant B. quintana nuoK requires specific storage and handling conditions to maintain stability and activity:

• Storage temperature: -20°C to -80°C for long-term storage

• Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

• Recommended reconstitution: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Stabilizers: Addition of 5-50% glycerol (final concentration) for aliquots stored at -20°C/-80°C

• Working aliquots: Can be stored at 4°C for up to one week

It is critical to avoid repeated freeze-thaw cycles as these can lead to protein denaturation and loss of activity. Brief centrifugation prior to opening vials is recommended to bring contents to the bottom, especially for lyophilized preparations .

How can researchers design experiments to investigate nuoK's role in B. quintana pathogenesis?

Investigating nuoK's role in B. quintana pathogenesis requires a multifaceted experimental approach:

• Gene knockout/knockdown studies:

  • CRISPR-Cas9 or homologous recombination techniques to create nuoK mutants

  • Analysis of mutant phenotypes in culture and infection models

  • Complementation studies to confirm specificity of observed effects

• Protein interaction studies:

  • Co-immunoprecipitation to identify binding partners

  • Bacterial two-hybrid assays to map protein-protein interactions

  • Cross-linking studies to capture transient interactions

• Functional assays:

  • Measurement of membrane potential in wild-type vs. nuoK mutants

  • Assessment of NADH dehydrogenase activity using spectrophotometric methods

  • Oxygen consumption and respiratory chain function analysis

• Infection models:

  • Cell culture systems using erythrocytes or erythroblasts, as B. quintana is known to reside in these cells during bacteremia

  • Assessment of bacterial survival and replication in the presence of nuoK inhibitors

  • Evaluation of host cell responses to wild-type vs. nuoK-deficient bacteria

• Structural biology approaches:

  • Cryo-EM or X-ray crystallography of the complete NADH dehydrogenase complex

  • Molecular dynamics simulations to understand conformational changes

These approaches can help elucidate whether nuoK contributes to key aspects of B. quintana pathogenesis, including survival in human erythrocytes, persistence during chronic infection, and adaptation to different host environments.

What are the challenges in developing antibodies against recombinant nuoK for research applications?

Developing antibodies against nuoK presents several significant challenges:

• Membrane protein antigenicity issues:

  • Hydrophobic transmembrane domains are often poorly immunogenic

  • Native conformation may be difficult to maintain during immunization

  • Limited exposed epitopes for antibody recognition

• Specificity concerns:

  • Potential cross-reactivity with homologous proteins from related bacteria

  • Difficulty distinguishing between nuoK variants from different Bartonella species

  • Background reactivity with E. coli proteins if using recombinant proteins expressed in E. coli

• Technical approaches to overcome these challenges:

  • Use of synthetic peptides corresponding to predicted extramembrane loops

  • Generation of antibodies against denatured whole protein followed by extensive validation

  • Phage display techniques to select high-affinity binders

  • Monoclonal antibody development with rigorous specificity screening

• Validation strategies:

  • Western blotting against recombinant protein and native bacterial lysates

  • Immunoprecipitation followed by mass spectrometry

  • Immunofluorescence microscopy with appropriate controls

  • Testing against nuoK knockout strains to confirm specificity

Researchers should consider collaboration with specialized antibody development services with experience in membrane protein antibodies for optimal results.

How does nuoK contribute to the energy metabolism of B. quintana in different host environments?

B. quintana must adapt its energy metabolism to survive in diverse host environments, including the bloodstream during bacteremia and the human body louse vector . The role of nuoK likely varies across these niches:

• In erythrocytes during bacteremia:

  • Contribution to adaptation to low-oxygen conditions

  • Potential role in utilizing host-derived metabolites

  • Possible involvement in maintaining membrane potential under nutrient limitation

• During louse vector colonization:

  • Adjustment to temperature fluctuations

  • Adaptation to alternative energy sources

  • Potential regulation of respiratory activity during transmission

• Experimental approaches to study these adaptations:

  • Transcriptomic analysis of nuoK expression under different conditions

  • Metabolomic profiling of wild-type vs. nuoK mutants

  • Isotope labeling to track metabolic flux through respiratory pathways

  • Measurement of ATP synthesis rates in different simulated environments

• Comparative analysis with other pathogens:

  • Examination of nuoK function in related Bartonella species with different host preferences

  • Comparison with respiratory chain adaptations in other vector-borne pathogens

Understanding these adaptations may provide insights into B. quintana's remarkable persistence in human hosts, which can result in chronic bacteremia lasting for months or years .

What is the potential of nuoK as a diagnostic or therapeutic target for B. quintana infections?

The potential of nuoK as a diagnostic or therapeutic target can be evaluated from several perspectives:

• Diagnostic applications:

  • Development of serological assays using recombinant nuoK to detect antibodies in patient samples

  • PCR-based detection of the nuoK gene in clinical specimens

  • Mass spectrometry identification of nuoK peptides in patient samples

• Therapeutic targeting potential:

  • Assessment of nuoK essentiality through gene knockdown studies

  • Rational design of inhibitors targeting the NADH dehydrogenase complex

  • Evaluation of existing respiratory chain inhibitors for activity against B. quintana

• Advantages of nuoK as a target:

  • Highly conserved within B. quintana strains

  • Essential metabolic function

  • Structural differences from human respiratory complexes

• Experimental considerations:

  • Validation of target accessibility in intact bacteria

  • Specificity testing against human mitochondrial complexes

  • Assessment of resistance development potential

• Integration with existing diagnostic methods:

  • Current B. quintana diagnosis relies on serological testing, culture, and PCR

  • nuoK-based diagnostics could complement these approaches, especially for challenging cases like culture-negative endocarditis

The development of nuoK-based diagnostics could be particularly valuable given the challenges in detecting B. quintana using current methods, where blood cultures can take several days to weeks and may yield false negatives even in infected patients .

What are the most effective purification strategies for recombinant nuoK to maintain its native conformation?

Purifying membrane proteins like nuoK while preserving native conformation requires specialized approaches:

• Solubilization strategies:

• Purification workflow:

  • Cell lysis under gentle conditions (e.g., French press, sonication)

  • Membrane fraction isolation by ultracentrifugation

  • Controlled solubilization with optimized detergent concentration

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for increased purity

  • Optional reconstitution into liposomes or nanodiscs for functional studies

• Quality control assessments:

  • Circular dichroism to verify secondary structure

  • Fluorescence spectroscopy to assess tertiary structure

  • Blue native PAGE to evaluate oligomeric state

  • Activity assays to confirm functional integrity

When working with B. quintana nuoK, researchers should consider that the recombinant protein is typically provided lyophilized and requires careful reconstitution in appropriate buffers . The choice of purification strategy should align with the intended experimental application.

How can researchers validate the biological activity of purified recombinant nuoK?

Validating the biological activity of recombinant nuoK requires multiple complementary approaches:

• Structural integrity assessment:

  • Circular dichroism spectroscopy to confirm secondary structure

  • Thermal shift assays to evaluate protein stability

  • Limited proteolysis to assess proper folding

• Functional assays:

  • NADH:ubiquinone oxidoreductase activity measurement

  • Electron transfer rate determination

  • Reconstitution with other subunits to assess complex formation

  • Membrane incorporation efficiency in liposome systems

• Interaction studies:

  • Binding assays with known interaction partners

  • Co-precipitation of associated complex components

  • Surface plasmon resonance to measure binding kinetics

• Comparative analysis:

  • Activity comparison with native protein purified from B. quintana

  • Benchmarking against homologous proteins from related species

• Functional complementation:

  • Ability to restore activity in nuoK-deficient bacterial strains

  • Rescue of phenotypic defects in knockout models

These validation approaches help ensure that the recombinant protein maintains its native properties and provides reliable results in downstream applications.

What experimental controls are essential when studying nuoK's role in B. quintana physiology?

Rigorous experimental controls are critical for reliable research on nuoK function:

• Genetic controls:

  • nuoK knockout strains as negative controls

  • Complemented knockout strains to confirm phenotype specificity

  • Strains with point mutations in catalytic residues to distinguish structural vs. catalytic roles

• Protein-level controls:

  • Denatured nuoK protein as negative control

  • Related NADH dehydrogenase subunits as specificity controls

  • nuoK homologs from other Bartonella species for evolutionary comparisons

• Technical controls for key methodologies:

• Controls for environmental variables:

  • Temperature

  • pH

  • Oxygen concentration

  • Growth phase standardization

• Statistical approaches:

  • Appropriate replication (minimum n=3 for biochemical assays)

  • Power analysis to determine sample size for in vivo experiments

  • Blinding procedures where applicable

  • Multiple statistical tests to confirm significance

Implementing these controls helps ensure experimental rigor and reproducibility in nuoK research.

How does the study of nuoK contribute to our understanding of B. quintana's evolutionary history?

The study of nuoK provides valuable insights into B. quintana's evolutionary trajectory:

• Phylogenetic implications:

  • Sequence conservation analysis of nuoK across Bartonella species

  • Comparison with homologs in other alpha-proteobacteria

  • Evidence of selective pressure on respiratory chain components

• Host adaptation signatures:

  • Comparison of nuoK sequences between B. quintana (human-specific) and other host-adapted Bartonella species

  • Identification of amino acid changes that correlate with host specificity

  • Assessment of purifying vs. diversifying selection on different protein domains

• Historical perspectives:

  • Analysis of nuoK in ancient B. quintana DNA recovered from archaeological remains

  • Correlation of genetic changes with historical epidemics

  • Study of nuoK conservation across the five millennia of B. quintana presence in human populations

• Methodological approaches:

  • Whole genome sequencing of modern and ancient isolates

  • Molecular clock analysis to date divergence events

  • Reconstruction of ancestral sequences to understand evolutionary trajectories

  • Analysis of dental pulp specimens from archaeological sites for B. quintana DNA

Archaeological evidence has shown B. quintana bacteremia in human populations dating back to the 1st century, with detection in 19.3% of individuals across multiple archaeological sites . Studying nuoK in these ancient samples could provide insights into the adaptation of B. quintana's energy metabolism throughout human history.

What are the emerging technologies that can advance nuoK research?

Several cutting-edge technologies hold promise for advancing nuoK research:

• Cryo-electron microscopy (Cryo-EM):

  • High-resolution structural analysis of entire respiratory complexes

  • Visualization of nuoK in its native membrane environment

  • Capture of different conformational states during electron transport

• Single-molecule techniques:

  • FRET-based approaches to study conformational changes

  • Optical tweezers to measure force generation

  • Single-molecule tracking in live bacteria

• CRISPR-based technologies:

  • CRISPRi for tunable repression of nuoK expression

  • Base editing for precise mutation introduction

  • CRISPR screening to identify genetic interactions

• Advanced imaging:

  • Super-resolution microscopy to visualize respiratory complex organization

  • Correlative light and electron microscopy (CLEM)

  • Label-free imaging techniques to study native complexes

• Artificial intelligence and computational approaches:

  • Machine learning for structure prediction

  • Molecular dynamics simulations of membrane-embedded complexes

  • Systems biology modeling of respiratory chain function

• Microfluidic systems:

  • Single-cell analysis of bacterial metabolism

  • Precisely controlled environmental conditions

  • Real-time monitoring of respiratory activity

These technologies can provide unprecedented insights into nuoK function and its role in B. quintana pathogenesis and metabolism.

How can recombinant nuoK be utilized in epidemiological studies of B. quintana infections?

Recombinant nuoK offers several applications in epidemiological research on B. quintana:

• Serological surveillance:

  • Development of ELISA assays using recombinant nuoK to detect antibodies in population studies

  • Assessment of exposure rates in high-risk groups (homeless populations, areas with poor hygiene)

  • Correlation of antibody titers with clinical manifestations

• Strain typing and diversity studies:

  • Analysis of nuoK sequence variants across clinical isolates

  • Development of nuoK-based typing methods

  • Association of specific variants with geographic distribution or disease severity

• Historical epidemiology:

  • Comparative analysis of nuoK in contemporary and ancient samples

  • Tracing the evolution of B. quintana across different historical periods

  • Understanding changing patterns of human-pathogen interaction

• One Health approaches:

  • Investigation of nuoK in the context of vector-host-pathogen interactions

  • Study of transmission dynamics between humans and body lice

  • Environmental surveillance for B. quintana

• Implementation strategies:

  • Development of field-applicable diagnostic tests

  • Training programs for healthcare workers in endemic areas

  • Integration with existing surveillance systems for neglected diseases

The historical presence of B. quintana in 19.3% of individuals across archaeological sites from the 1st to 19th centuries suggests this pathogen has been a significant human parasite throughout recorded history, making epidemiological studies particularly valuable for understanding its persistence.

How does nuoK from B. quintana compare to homologous proteins in other bacterial pathogens?

Comparative analysis of nuoK across species provides valuable evolutionary and functional insights:

Key research approaches for comparative studies include:

• Reciprocal complementation experiments

• Chimeric protein construction to identify functional domains

• Comparative structural modeling

• Evolution rate analysis to identify regions under selection

These comparative analyses can help identify conserved functional elements and species-specific adaptations that may contribute to pathogenesis or host specificity.

What can researchers learn from studying nuoK mutations in clinical isolates of B. quintana?

Analysis of nuoK variations in clinical isolates can provide valuable insights:

• Mutational patterns:

  • Identification of conserved vs. variable regions

  • Hot spots for natural variation

  • Correlation with geographical distribution or clinical presentation

• Functional consequences:

  • Impact on energy metabolism efficiency

  • Effects on bacterial fitness in different environments

  • Potential role in antimicrobial resistance

• Clinical correlations:

  • Association with disease severity (trench fever vs. endocarditis vs. bacillary angiomatosis)

  • Relationship to chronic bacteremia persistence

  • Links to specific risk factors (homelessness, alcoholism, lice infestation)

• Methodological approaches:

  • Whole genome sequencing of clinical isolates

  • Site-directed mutagenesis to recreate clinical variants

  • Phenotypic characterization of mutant strains

  • Biochemical analysis of variant proteins

• Experimental design considerations:

  • Sample size determination based on expected mutation frequency

  • Standardized culture conditions to minimize environmental variables

  • Appropriate statistical analysis for population genetics

  • Control for patient demographics and clinical factors

This research direction is particularly relevant given B. quintana's reemergence in urban homeless populations and its association with serious complications like endocarditis and bacillary angiomatosis .