Recombinant Bartonella quintana Type IV secretion system protein virB10 (virB10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
virB10; BQ10610; Type IV secretion system protein virB10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Target Names
virB10
Target Protein Sequence
MKDEIDENNINDRSTIKDGQGKKLHSNTSKAVALLVLLGVCGYLAYSTLITNKKQPVELP KEAIIKQTERFRPAQPKPVLLEPTEKNNLLLPKVELPTPKRNQTNADDSLLEAAQRAPVL AYASPQKSQANAEKNNDTSPNQLERKPDETAQRFNHLLKPTNLEGIHASTLTNRNYIIAM GASIPCILETAISSDQQGFTSCIVSRDILSDNGRVVLLDKGTQIVGEYRSGLKKGQNRLF VLWNRAKTPSGVIITLASPATDALGRSGVDGDVDNHWFERIGSALLVSIVRDATNYARNR LPKDQDKNSSDTISSGPNIANIVVENYANIPPTLTKNQGEMVNVFVARDLDFSSVYKLKV IEDKKQIVNRSISRNFYKNSAVILK
Uniprot No.

Target Background

Function
Recombinant *Bartonella quintana* Type IV secretion system protein VirB10 is a component of the VirB/VirD4 type IV secretion system, potentially acting as a key virulence factor in the subversion of human endothelial cell (HEC) function.
Database Links

KEGG: bqu:BQ10610

STRING: 283165.BQ10610

Protein Families
TrbI/VirB10 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of VirB10 in the Bartonella Type IV secretion system?

VirB10 is a critical structural component of the Bartonella Type IV secretion system (T4SS), functioning as part of the "core complex" along with VirB7 and VirB9. This core complex is essential for T4SS biogenesis and function. VirB10 has a unique architecture that spans the entire cell envelope, connecting the inner and outer membranes of the bacterial cell .

Functionally, VirB10 acts as a regulator of substrate passage through the secretion channel. It undergoes conformational changes in response to ATP consumption by the VirB/D4 ATPases, which is required for DNA and protein substrate transfer across the outer membrane . This energy-sensing capability makes VirB10 a key control point in the T4SS machinery, essentially serving as a gatekeeper that regulates when macromolecules can be transported through the system.

How should researchers optimize expression and purification of recombinant B. quintana VirB10?

For optimal expression of recombinant B. quintana VirB10, consider the following methodological approach:

Expression System Selection:

  • E. coli BL21(DE3) or similar strains are recommended for VirB10 expression, cultured in lysogeny broth (LB) at 37°C with appropriate antibiotics .

  • Consider using a low-copy vector with an inducible promoter (such as T7) to control expression levels.

  • Incorporate affinity tags (His6, GST, or MBP) at either the N- or C-terminus, with a TEV protease cleavage site for tag removal.

Expression Optimization:

  • Test induction at different optical densities (OD600 of 0.6-0.8 is typical)

  • Vary inducer concentrations (typically 0.1-1.0 mM IPTG)

  • Test expression at different temperatures (16°C, 25°C, 30°C, 37°C)

  • Evaluate expression time (4h vs overnight)

Purification Protocol:

  • Cell lysis using sonication or French press in a buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

  • Initial purification via affinity chromatography (Ni-NTA for His-tagged protein)

  • Optional tag removal using TEV protease

  • Secondary purification via size exclusion chromatography

  • Analyze purity by SDS-PAGE and Western blotting using anti-VirB10 antibodies

Note that VirB10's membrane-spanning nature can complicate expression and purification, so inclusion of mild detergents (0.05-0.1% DDM or LDAO) in buffers may be necessary to maintain solubility and native conformation.

How do protein-protein interactions shape VirB10 function within the T4SS complex?

VirB10 engages in multiple protein-protein interactions that are crucial for T4SS assembly and function. Based on yeast two-hybrid analysis of the related B. henselae system, VirB10 interacts with several other VirB proteins, notably:

Interacting PartnerInteraction StrengthFunctional Significance
VirB7StrongOuter membrane anchoring
VirB9Strong bidirectionalCore complex formation
VirB8ModerateInner membrane complex formation
VirB11 (ATPase)ModerateEnergy coupling for conformational changes
Self (VirB10)DetectedOligomerization into ring-like structures

These interactions position VirB10 as a central coordinator in the T4SS architecture . The interaction with VirB9 is particularly notable as it was observed to be bidirectional in yeast two-hybrid assays, with the strongest interaction occurring between VirB9 prey and VirB7 bait constructs .

For investigating these interactions, researchers should consider:

  • Yeast two-hybrid assays for initial interaction mapping

  • Co-immunoprecipitation to confirm interactions in bacterial cells

  • Bacterial two-hybrid systems for interaction studies in a prokaryotic environment

  • Cross-linking coupled with mass spectrometry to identify interaction interfaces

  • FRET or BRET assays for dynamic interaction analysis in live cells

Understanding these interactions is critical for deciphering how signals are transmitted through the secretion apparatus and how substrate specificity is maintained.

What experimental approaches can determine VirB10's conformational changes in response to ATP?

VirB10 undergoes significant conformational changes in response to ATP energy consumption by the T4SS ATPases. These structural transitions are essential for outer membrane channel formation or gating . To study these conformational dynamics, researchers can employ:

Biochemical Approaches:

  • Limited proteolysis assays comparing ATP-bound and ATP-free states

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map regions of altered solvent accessibility

  • Cross-linking coupled with mass spectrometry to capture different conformational states

  • ATP hydrolysis assays using purified VirB10 in complex with VirB4/VirB11 ATPases

Biophysical Techniques:

  • Circular dichroism (CD) spectroscopy to monitor secondary structure changes

  • Fluorescence spectroscopy with strategically placed fluorophores to detect domain movements

  • FRET-based sensors incorporating VirB10 domains to monitor real-time conformational changes

  • Single-molecule FRET to detect population distributions of different conformational states

Structural Methods:

  • Cryo-electron microscopy of the T4SS complex with and without ATP

  • X-ray crystallography of VirB10 in different nucleotide-bound states

  • Small-angle X-ray scattering (SAXS) to capture solution dynamics

Research has demonstrated that ATP depletion in cells affects VirB10 conformation, and interestingly, the G272R mutation renders VirB10 conformationally insensitive to cellular ATP levels . This suggests that the G272 region may be critical for transmitting ATP-sensing signals throughout the protein structure.

How does the G272R mutation in VirB10 mechanistically allow substrate release while blocking pilus production?

The G272R mutation in VirB10 represents a fascinating uncoupling of two T4SS functions that are normally coordinated: substrate transfer and pilus biogenesis. This mutation results in a Tra+ (substrate transfer positive) but Pil- (pilus production negative) phenotype .

Molecular Mechanism Analysis:

The G272R mutation appears to lock VirB10 in a conformation that allows for unregulated release of secretion substrates (such as VirE2) to the cell surface, independent of target cell contact . This suggests that G272 is located at a critical regulatory junction in the protein structure.

Based on the available data, we can propose a mechanistic model:

  • In wild-type VirB10, the G272 region likely participates in conformational switching between:

    • A "closed" state that retains substrates within the secretion channel

    • An "open" state that permits substrate passage triggered by ATP consumption and target cell contact

  • The G272R mutation introduces a bulky, positively charged arginine that likely:

    • Disrupts local protein folding due to steric hindrance

    • Creates new ionic interactions that stabilize the "open" conformation

    • Renders the protein insensitive to ATP-dependent regulatory signals

  • Pilus assembly specifically requires:

    • Proper cycling between conformational states

    • Coordinated assembly of pilin subunits (VirB2)

    • Correct positioning of VirB proteins at the outer membrane

Experimental Approaches to Study This Mechanism:

TechniqueApplicationExpected Outcome
Site-directed mutagenesisGenerate variants at position 272 with different propertiesDetermine which physicochemical properties are crucial
Cysteine accessibility scanningMap exposed regions in WT vs. G272RIdentify conformational differences
Formaldehyde cross-linkingAnalyze DNA-protein interactionsDetermine how G272R affects substrate binding
Co-immunoprecipitationCompare protein interaction profilesIdentify altered protein-protein interactions
Cryo-EM structural analysisCompare WT and G272R structuresVisualize conformational differences

This mutant provides a valuable tool for dissecting the dual functions of the T4SS and understanding how substrate transfer and pilus biogenesis can be mechanistically separated.

What strategies can be employed to study the role of VirB10 in translocation of Bartonella effector proteins?

Bartonella effector proteins (Beps) are critical virulence factors translocated into host cells via the VirB/VirD4 T4SS to modulate host cellular functions and dampen immune responses . Studying VirB10's specific role in this process requires sophisticated experimental approaches:

Translocation Assay Systems:

  • Split NanoLuc Luciferase Assay:

    • This system has been successfully implemented in B. taylorii for studying BepD translocation

    • One fragment of the luciferase is fused to the effector protein

    • The complementary fragment is expressed in host cells

    • Translocation results in reconstitution of luciferase activity that can be quantitatively measured

    • This system could be adapted for B. quintana effector translocation studies

  • TEM-1 β-lactamase Fusion Assay:

    • Effector proteins are fused to TEM-1 β-lactamase

    • Host cells are loaded with CCF2/AM substrate

    • Successful translocation cleaves the substrate, changing fluorescence from green to blue

    • This allows for single-cell analysis of translocation efficiency

  • CyaA Adenylate Cyclase Reporter System:

    • Effector-CyaA fusions produce cAMP only when translocated into eukaryotic cells

    • cAMP levels can be measured by ELISA or reporter cell lines

    • Particularly useful for quantitative analysis of translocation efficiency

Optimizing VirB10-dependent Translocation:

Research with B. taylorii has shown that specific growth conditions significantly impact T4SS activity. For optimal effector translocation through VirB10-containing T4SS:

  • Grow bacteria on tryptic soy agar (TSA) plates rather than in liquid medium

  • Implement a temperature shift immediately before infection

  • Use pH-controlled media (pH 7.0-7.8) to activate the BatR/BatS two-component system

  • Consider the metabolic state of the bacteria, as the stringent response affects T4SS expression via RpoH1

VirB10 Mutagenesis Strategy:

A comprehensive mutagenesis approach should target:

  • The periplasmic domain involved in core complex formation

  • The transmembrane region spanning the outer membrane

  • The ATP-sensing domains that communicate with VirB11 ATPase

  • The G272 region implicated in conformational regulation

Each mutant should be assessed for:

  • Expression levels by Western blot

  • Localization by fractionation and immunofluorescence

  • Core complex formation by co-immunoprecipitation

  • Effector translocation efficiency using reporter systems

  • Host cell phenotypes (e.g., VEGF induction, immunomodulation)

How can in vivo and in vitro models be integrated to comprehensively study VirB10 function in Bartonella infection?

A significant challenge in Bartonella research has been the disparity between in vitro systems and relevant in vivo models . An integrated approach combining both systems would provide the most comprehensive understanding of VirB10 function.

Recommended Integrated Approach:

  • In Vitro Cellular Models:

    • Utilize both THP-1-derived macrophages and endothelial cells (HUVECs)

    • Implement optimized infection protocols with temperature shifts and appropriate growth media

    • Measure multiple readouts:

      • Bacterial adhesion and invasion using gentamicin protection assays

      • Effector translocation using reporter systems

      • Host cell responses (cytokine production, VEGF secretion)

      • Transcriptomic changes in host cells

  • Mouse Model Implementation:

    • The improved B. taylorii mouse infection model allows infection with reduced inoculum

    • B. taylorii can be used as a surrogate for studying B. quintana VirB10 function by:

      • Creating chimeric T4SS systems with B. quintana VirB10

      • Monitoring bacteremia over time

      • Analyzing tissue tropism and persistence

      • Evaluating immune responses to infection

  • Cross-System Validation:

ParameterIn Vitro MeasurementIn Vivo Correlation
T4SS expressionqRT-PCR, Western blotTissue-recovered bacteria analysis
Effector translocationReporter assaysTissue immunohistochemistry
VirB10 conformationBiochemical assaysEx vivo analysis of recovered bacteria
Host responseCell culture cytokine profileSerum cytokine measurements
VirB10 mutation effectsCellular infection assaysVirulence and persistence in mice
  • VirB10 Structural Considerations:

    • Verify that your recombinant VirB10 constructs maintain the critical structural features:

      • The bipartite translocation signal with BID domain

      • The proper surface charge distribution

      • Key interaction interfaces with other VirB components

This integrated approach addresses the challenge noted in the literature that "disparities of in vitro and in vivo studies in different species have hampered progress in our understanding of Bartonella pathogenesis" by creating a cohesive experimental framework.

What are the most promising therapeutic targets within the VirB10 structure?

The central role of VirB10 in the T4SS functionality makes it an attractive therapeutic target. Based on the available data, several regions show particular promise:

  • ATP-sensing domain: Compounds that lock VirB10 in its ATP-unbound conformation could prevent the conformational changes necessary for substrate translocation .

  • G272 region: The G272R mutation demonstrates that this region is critical for regulating substrate passage. Small molecules binding to this region could potentially mimic the effects of this mutation but in a controlled manner .

  • Core complex interaction interfaces: Disrupting the interactions between VirB10 and other core complex components (VirB7, VirB9) could destabilize the entire secretion system .

  • Membrane-spanning domains: These regions are essential for bridging the periplasmic space and forming a continuous channel. Compounds that destabilize these structures could collapse the secretion pathway.

Research approaches should include:

  • In silico screening against VirB10 structural models

  • Fragment-based drug discovery using purified VirB10 domains

  • Peptide inhibitors derived from natural VirB10 interaction partners

  • High-throughput screening using T4SS functional assays

What technical challenges remain in studying recombinant VirB10 structure and function?

Despite significant advances, several technical challenges persist in VirB10 research:

  • Structural complexity: VirB10's membrane-spanning nature makes it difficult to study using traditional structural biology approaches. Detergent selection and membrane mimetics remain challenging for maintaining native conformation during purification.

  • Functional reconstitution: Creating a minimal functional T4SS in vitro for mechanistic studies has not been achieved. This would require co-expression and assembly of multiple VirB components in the correct stoichiometry.

  • Conformational dynamics: The transient nature of VirB10's conformational states makes them difficult to capture. Advanced techniques like time-resolved cryo-EM or single-molecule FRET are needed but technically demanding.

  • Translocation mechanisms: The precise pathway of substrates through the T4SS remains poorly understood. Developing assays that can track substrates in real-time during translocation would represent a major advance.

  • Species-specific differences: Differences in VirB10 regulation between Bartonella species complicate the transfer of findings between systems . Comparative studies across species are needed to identify conserved mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.