Recombinant Bartonella quintana Type IV secretion system protein virB3 (virB3)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant VirB3 is produced in Escherichia coli with an N-terminal histidine (His) tag for purification and detection. It corresponds to the full-length VirB3 protein of Bartonella quintana, spanning residues 1–103 .

Comparative Analysis with B. henselae VirB3:

FeatureB. quintana VirB3B. henselae VirB3
Sequence Identity84%Reference (Q9S3N1)
Key ResiduesTyr-97, Lys-98 (C-terminal)Asp-97, His-98
Host ExpressionE. coliE. coli

Research Applications

Recombinant VirB3 is utilized in:

  • Protein-Protein Interaction Studies: Yeast two-hybrid and pull-down assays to map T4SS assembly .

  • Antibody Production: Immunization for generating VirB3-specific antibodies .

  • Structural Biology: Crystallization trials to resolve secretion machinery architecture .

Functional Insights from Studies

  • Role in Pathogenesis: VirB3 is critical for effector protein translocation (e.g., Beps), which modulate host cell processes such as apoptosis inhibition and cytoskeletal remodeling .

  • Energy Transduction: Collaborates with VirB4 and VirB11 ATPases to energize substrate transport .

Limitations and Future Directions

  • Species-Specificity: The VirB3-VirB5 interaction observed in B. henselae remains unconfirmed in B. quintana .

  • Structural Data: High-resolution structures are needed to elucidate conformational changes during secretion.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
virB3; BQ10540; Type IV secretion system protein virB3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Target Names
virB3
Target Protein Sequence
MNEDTLFLACTRPATFAGVTMEGMALNVMATSILFILTSNFTMIGLGIGLHFVLREVTKY DHNQFRVLFAWLNTRGKQKNLTRWGGGSTSPLRLIRTYKELNR
Uniprot No.

Target Background

Function
VirB3 is a component of the type IV secretion system VirB/VirD4, which is a major virulence determinant for disrupting human endothelial cell (HEC) function. VirB3 may play a role in stabilizing the pilus structure.
Database Links

KEGG: bqu:BQ10540

STRING: 283165.BQ10540

Protein Families
VirB3 family
Subcellular Location
Cell outer membrane; Single-pass membrane protein.

Q&A

What is the Type IV Secretion System in Bartonella quintana?

The Type IV Secretion System (T4SS) in Bartonella quintana is a specialized macromolecular transport apparatus ancestrally related to bacterial conjugation machinery. This system enables the transfer of diverse macromolecules, including DNA and proteins, across kingdom boundaries through a cell contact-dependent mechanism . The T4SS is assembled from multiple protein subunits encoded by the virB operon (virB1 to virB11) and plays a critical role in bacterial pathogenicity by delivering effector proteins that manipulate host cell functions. In Bartonella species, the T4SS is essential for establishing persistent infections within mammalian hosts, facilitating intracellular survival, and enabling host-adaptation mechanisms .

What is the predicted structure and localization of VirB3 protein?

VirB3 is predicted to be a bitopic or polytopic membrane protein containing one or two transmembrane helices typically located within residues 15-57 . The protein primarily localizes to the bacterial outer membrane, though smaller quantities have been detected in the inner membrane as well . This dual localization suggests a potential bridging function between different components of the T4SS machinery. The protein's membrane topology remains challenging to define precisely, which is consistent with difficulties encountered in studying VirB3 homologs in other bacterial T4SS . The structural characteristics of VirB3 are critical for its function, as they facilitate proper positioning within the secretion apparatus and enable interactions with other T4SS components.

How does VirB3 interact with other T4SS components?

VirB3 engages in several protein-protein interactions within the T4SS complex. Most notably, yeast two-hybrid studies have revealed a strong interaction between VirB3 and VirB5, which was identified as one of the most robust interactions among T4SS components . This interaction suggests VirB3 may play a direct role in pilus assembly or stabilization through its association with VirB5, a known pilus protein. Additionally, the highly conserved synteny of virB3 and virB4 genes across bacterial species indicates a likely interaction between these two proteins at or within the inner membrane . This hypothesis is supported by observations in Agrobacterium tumefaciens, where VirB4 is required to maintain normal levels of VirB3, suggesting a stabilizing interaction between these proteins .

What methods are used to study VirB3 protein expression and purification?

For recombinant expression of Bartonella VirB3, researchers typically employ bacterial expression systems using E. coli strains optimized for membrane protein production. The expression vector should contain a strong inducible promoter (such as T7 or tac) and fusion tags (such as His6, MBP, or GST) to facilitate purification and detection.

The purification protocol generally involves:

  • Cell lysis under conditions that preserve membrane protein structure, typically using detergents like n-dodecyl β-D-maltoside (DDM) or Triton X-100

  • Affinity chromatography using the fusion tag

  • Size exclusion chromatography to isolate pure protein complexes

For functional studies, the protein may be reconstituted into lipid bilayers or nanodiscs to maintain native conformation . When co-expression with partner proteins is desired, compatible plasmids carrying genes for interacting proteins (such as VirB4 or VirB5) can be co-transformed, as demonstrated in studies showing VirB3-VirB4 complex formation in a 1:1 ratio .

How do mutations in VirB3 affect T4SS function and bacterial pathogenicity?

Mutational analysis of VirB3 has revealed several critical regions essential for T4SS functionality and subsequent bacterial pathogenicity. The transmembrane domains of VirB3 (residues 15-57) are particularly important for proper membrane localization and protein stability . Mutations in these regions can prevent correct insertion into the bacterial membrane, resulting in degradation of the protein and complete loss of T4SS function.

The C-terminal region of VirB3 appears critical for interaction with VirB5, as demonstrated through yeast two-hybrid experiments . Mutations disrupting this interaction significantly impair pilus assembly and stability, reducing bacterial attachment to host cells and decreasing effector protein translocation efficiency.

Research has shown that VirB3-deficient Bartonella strains are unable to establish persistent bacteremia in mammalian models and show severely attenuated ability to induce angioproliferative lesions characteristic of bacillary angiomatosis. This indicates that VirB3 is essential for both initial infection and pathogenesis of Bartonella-associated diseases .

The methodology for studying these effects typically involves:

  • Site-directed mutagenesis of critical VirB3 residues

  • Complementation studies in VirB3 knockout strains

  • Assessment of T4SS assembly using electron microscopy

  • Measurement of effector protein translocation efficiency

  • In vivo infection models to evaluate pathogenicity

What are the species-specific differences in VirB3 structure and function among Bartonella species?

Comparative genomic analyses reveal notable differences in VirB3 proteins among Bartonella species that may reflect host-specific adaptations. While the core transmembrane topology is generally conserved, sequence variations occur primarily in the C-terminal region that mediates protein-protein interactions .

B. quintana VirB3 shows high sequence conservation among strains, consistent with the clonal population structure observed in this species . This limited genetic diversity reflects the specialized human-restricted host range of B. quintana and suggests strong selective pressure to maintain T4SS functionality in this specific host environment.

In contrast, B. henselae and B. grahamii display greater VirB3 sequence variability, potentially reflecting their broader host ranges and adaptation to different mammalian reservoirs . Phylogenetic studies of these species indicate that recombination events affect T4SS genes at higher rates than housekeeping genes, suggesting adaptive evolution of the secretion system .

Interestingly, these species-specific differences in VirB3 may influence interaction partners. The novel VirB3-VirB5 interaction observed in B. henselae may not be universally conserved across all Bartonella species due to sequence divergence in these proteins . Experimental approaches to investigate these differences include:

  • Heterologous complementation assays between species

  • Cross-species protein-protein interaction studies

  • Chimeric protein analysis to identify functionally important domains

  • Host cell infection assays comparing T4SS efficiency across species

How can structural studies of VirB3 inform therapeutic strategies against Bartonella infections?

Structural characterization of VirB3 presents significant challenges due to its membrane-embedded nature, but offers promising avenues for therapeutic development. While no crystal structure of Bartonella VirB3 is currently available, predictive modeling based on membrane topology and protein interaction data suggests potential binding pockets that could be targeted by small molecule inhibitors .

The VirB3-VirB4 and VirB3-VirB5 interfaces represent particularly attractive targets, as disruption of these interactions would likely prevent proper T4SS assembly and function . Targeting these protein-protein interactions rather than enzymatic activities may reduce selective pressure for resistance development.

Methodological approaches for structure-based drug discovery targeting VirB3 include:

  • Computational modeling of VirB3 structure using membrane protein prediction algorithms

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

  • Fragment-based screening against recombinant VirB3 in membrane mimetics

  • In silico docking of compound libraries to predicted binding pockets

  • Validation of hits using bacterial growth inhibition and T4SS functional assays

Such approaches are particularly relevant for developing new treatments against Bartonella endocarditis, where current antibiotic regimens may fail to completely eliminate infection within vegetations .

What are the optimal conditions for culturing Bartonella quintana for VirB3 studies?

Bartonella quintana is a fastidious organism requiring specialized culture conditions. For VirB3 expression studies, the following protocol has proven effective:

  • Use freshly prepared blood agar plates supplemented with 5% sheep blood

  • Maintain cultures at 37°C under humidified conditions with 5% CO2

  • Expect visible colonies after 5-14 days of incubation

  • For liquid culture, use brain heart infusion broth supplemented with hemin (35 μg/ml)

For studying VirB3 expression in clinical samples, a shell vial culture technique shows superior sensitivity:

  • Centrifuge blood or tissue samples with shell vials at 700 × g for 1 hour at 22°C

  • Remove inoculum and wash twice with sterile PBS

  • Incubate in appropriate medium at 37°C with 5% CO2

  • Change medium at 15 and 30 days

  • Detect Bartonella using immunofluorescence with anti-Bartonella antibodies

This shell vial culture approach has demonstrated 71% sensitivity for Bartonella detection, significantly higher than conventional culture methods . For patients with suspected endocarditis, antibiotic therapy significantly affects culture results; blood culture positivity drops from 80% in untreated patients to 0% in those receiving antibiotics (p = 0.0006) .

How can yeast two-hybrid systems be optimized for studying VirB3 interactions?

The yeast two-hybrid system has proven valuable for identifying VirB3 interaction partners, particularly revealing the novel VirB3-VirB5 interaction . For optimal results when studying membrane proteins like VirB3, consider these methodological refinements:

  • Use specialized yeast two-hybrid vectors designed for membrane proteins, such as the split-ubiquitin system

  • Create both N-terminal and C-terminal fusions to account for potential topological constraints

  • Include appropriate controls:

    • Empty vector negative controls

    • Known interacting protein pairs as positive controls

    • Self-activation tests for all constructs

The strength of interactions can be quantitatively assessed using β-galactosidase activity assays, as demonstrated in studies showing the VirB3-VirB5 interaction produced the strongest signal among 17 combinations tested .

When designing constructs, careful consideration should be given to transmembrane domains. Truncated constructs omitting transmembrane regions may improve expression but risk eliminating critical interaction interfaces. A systematic approach testing multiple constructs with different domain boundaries is recommended.

What expression systems are most effective for producing recombinant VirB3 protein?

Producing functional recombinant VirB3 presents challenges due to its membrane localization and potential toxicity. Based on successful approaches with related proteins, the following expression systems merit consideration:

  • E. coli-based systems:

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Expression at reduced temperatures (16-20°C) to minimize inclusion body formation

    • Induction with low IPTG concentrations (0.1-0.5 mM)

    • Fusion to solubility-enhancing tags like MBP or SUMO

  • Cell-free expression systems:

    • Wheat germ or insect cell extracts supplemented with lipid nanodiscs

    • Direct incorporation into artificial membrane environments during synthesis

    • Reduced proteolytic degradation compared to bacterial systems

  • Co-expression strategies:

    • Simultaneous expression of VirB3 with natural binding partners like VirB4

    • Demonstrated to improve stability and solubility in other T4SS proteins

    • Allows purification of physiologically relevant complexes

For each system, optimization of detergent conditions during purification is critical. A detergent screen including mild options like DDM, LMNG, or digitonin should be performed to identify conditions that maintain VirB3 in a stable, functional state.

How can phylogenetic analyses inform our understanding of VirB3 evolution in Bartonella?

Phylogenetic analysis of VirB3 across Bartonella species provides valuable insights into evolutionary dynamics and host adaptation processes. Comparative studies have revealed significant differences in population structures and evolutionary patterns among Bartonella species .

When conducting phylogenetic analyses of VirB3, researchers should consider:

  • Recombination detection methods:

    • The relative frequency of recombination to mutation (r/m) varies significantly between Bartonella species

    • B. henselae shows approximately 10-fold higher recombination frequency than previously estimated from multilocus gene sets

    • Specialized algorithms like ClonalFrame or GARD should be employed to detect recombination events

  • Population structure comparison:

    • B. quintana isolates show identical VirB3 sequences, consistent with a clonal population structure

    • B. henselae displays greater sequence diversity with distinct phylogenetic clades

    • B. grahamii exhibits geographic clustering with monophyletic European and Asian strains

  • Cross-species horizontal gene transfer:

    • Evidence exists for horizontal transfer of VirB3 across Bartonella species with different host preferences

    • Some B. grahamii strains cluster with host-specific species like B. tribocorum (rat-associated) or B. vinsonii (dog-associated)

These analyses suggest that VirB3 and other T4SS components experience selective pressures related to host adaptation, potentially driving sequence diversity through recombination while maintaining functional constraints.

How can functional analyses distinguish between direct and indirect effects of VirB3 mutations?

Distinguishing direct functional impacts of VirB3 mutations from indirect effects caused by disruption of protein complexes requires sophisticated experimental approaches:

  • Complementation hierarchy analysis:

    • Systematic complementation of VirB3 mutants with wild-type or mutant forms of potential interaction partners

    • Reveals dependency relationships between T4SS components

    • Can identify suppressor mutations that restore function despite primary defects

  • In situ crosslinking approaches:

    • Chemical crosslinking combined with mass spectrometry (XL-MS)

    • Captures transient interactions in their native membrane environment

    • Maps proximity relationships between VirB3 and other T4SS components

  • Monitoring of protein stability and localization:

    • Fusion of VirB3 variants to fluorescent proteins or epitope tags

    • Quantitative assessment of protein levels by western blotting

    • Immunofluorescence microscopy to determine subcellular localization

  • Structure-function correlation:

    • Site-directed mutagenesis targeting specific domains

    • Assessment of impact on discrete functions (protein interaction, membrane insertion, complex assembly)

    • Development of allelic series with graduated phenotypic effects

These approaches allow researchers to distinguish between mutations that directly disrupt VirB3 function versus those that indirectly affect T4SS assembly or stability through altered protein-protein interactions.

How can VirB3 studies advance diagnostic approaches for Bartonella infections?

Understanding VirB3 biology has significant implications for improving Bartonella diagnostics, particularly for challenging clinical presentations like endocarditis and bacillary angiomatosis:

  • PCR-based detection targeting virB3:

    • Development of specific primers targeting conserved regions of virB3

    • Useful for direct detection in clinical samples when culture is negative

    • Particularly valuable after antibiotic administration, when cultures yield negative results despite ongoing infection

  • Serological assays based on recombinant VirB3:

    • Production of recombinant VirB3 for antibody detection

    • Potential marker for active infection versus past exposure

    • May complement current serological assays with improved specificity

  • Culture enhancement strategies:

    • For blood cultures, systematic subculture of blood culture broth onto specialized media shows higher efficiency than direct blood plating (98% vs. 10% sensitivity, p < 10^-7)

    • Shell vial culture technique demonstrates 71% sensitivity for Bartonella detection

    • Combined approaches reaching 100% sensitivity when used together

It's important to note that diagnostic strategies may need to differ based on the clinical presentation. For instance, the isolation rate of B. henselae from PCR-positive lymph nodes in cat scratch disease patients (13%) is significantly lower than from endocarditis valve specimens or bacillary angiomatosis skin biopsies (33%, p = 0.084) .

What is the potential for targeting VirB3 in antimicrobial development?

The essential role of VirB3 in T4SS function makes it an attractive target for novel antimicrobial development against Bartonella infections:

  • Target validation approaches:

    • Genetic knockout studies demonstrating attenuated virulence in VirB3-deficient strains

    • Complementation experiments confirming specific role of VirB3 in pathogenesis

    • Animal models showing reduced bacterial persistence when T4SS function is compromised

  • Small molecule screening strategies:

    • Development of cell-based reporter assays measuring T4SS-dependent effector translocation

    • High-throughput screening of compound libraries against recombinant VirB3

    • Fragment-based drug discovery targeting specific protein-protein interfaces

  • Peptidomimetic inhibitors:

    • Design of peptides mimicking VirB3 interaction domains

    • Potential to disrupt critical protein-protein interactions within the T4SS complex

    • May offer higher specificity than traditional antibiotics

  • Combination therapy approaches:

    • T4SS inhibitors could enhance antibiotic efficacy, particularly for intracellular bacteria

    • Potential to prevent treatment failures in endocarditis, where current antibiotic regimens may fail to completely eradicate infection

The ideal VirB3-targeting antimicrobial would selectively inhibit pathogenic Bartonella species while minimizing disruption of beneficial microbiota, addressing an important limitation of conventional broad-spectrum antibiotics.

What are the most promising future research directions for VirB3 studies?

Several emerging areas represent particularly promising directions for advancing our understanding of VirB3 biology and its applications:

  • Structural biology approaches:

    • Cryo-electron microscopy of intact T4SS complexes including VirB3

    • X-ray crystallography or NMR studies of VirB3 domains

    • Computational modeling integrated with experimental constraints

  • Systems biology integration:

    • Comprehensive mapping of the VirB3 interactome under various conditions

    • Temporal analysis of T4SS assembly with VirB3 as a focal point

    • Integration of transcriptomic and proteomic data to understand regulation

  • Host-pathogen interaction studies:

    • Identification of host factors that interact with the T4SS apparatus

    • Investigation of host immune responses to T4SS components

    • Comparative studies across different mammalian host systems

  • Translational applications:

    • Development of VirB3-based vaccines or diagnostics

    • Design of narrow-spectrum antimicrobials targeting specific Bartonella species

    • Creation of attenuated strains for research and potential vaccine development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.