Recombinant Bartonella quintana Type IV secretion system protein virB6 (virB6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Pathogenesis

The VirB/D4 T4SS in B. quintana delivers Bartonella effector proteins (Beps) into host cells, modulating cellular processes such as angiogenesis and apoptosis .

  • VEGF Secretion: VirB6-expressing B. quintana strains induce VEGF secretion in macrophages and epithelial cells, promoting vasculoproliferative disorders .

  • Effector Translocation: The BID (Bep intracellular delivery) domain in Beps relies on VirB6 for translocation, enabling subversion of host signaling pathways (e.g., Rac1 AMPylation, vimentin modification) .

Genetic and Evolutionary Insights

  • Operon Structure: The virB operon in B. quintana includes virB2–virB11 and virD4, with virB6 showing moderate sequence divergence compared to B. henselae (Ka/Ks=0.107K_a/K_s = 0.107) .

  • Pseudogenization: Some B. quintana strains exhibit partial gene loss in the virB locus, reducing T4SS functionality and host-cell adherence .

Research Applications

Recombinant VirB6 is utilized in:

  • Mechanistic Studies: Elucidating T4SS assembly via protein interaction assays .

  • Vaccine Development: Screening immunogenic components for anti-Bartonella therapies .

  • Host-Pathogen Interaction Models: Investigating Bep-mediated VEGF upregulation and actin cytoskeleton remodeling .

Challenges and Future Directions

  • Structural Resolution: Full-length VirB6 purification remains challenging due to its hydrophobic nature .

  • Species-Specific Variations: Functional differences between B. quintana VirB6 and homologs in Wolbachia or Agrobacterium warrant further study .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
virB6; BQ10570; Type IV secretion system protein VirB6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Bartonella quintana (strain Toulouse) (Rochalimaea quintana)
Target Names
virB6
Target Protein Sequence
MSDFSFSPFESISGYILNPLENAMNTTVSGLSSAISAPLNLASIIFIFLYGYNVMTGRVS LSMHSLLNNVVKIVVVTAMATNADTFNTYVKDIFFGDLANAIGNALNSNPASANVFDYIL LKTSARYQEVLAAAWFLEKIMVGLLGSLMIMAVIVFCIGGFIVQMFAQVALVMIIGLGPL FISLYLFNATRKFTDAWITTLINFTILQVLVIMLGTIMCKIILHVLNGTYDSIYFLFPPV VVISIVGAILFRALPGIASALSSGGPYFNAGISSGGQIFTMLSSGAKTGRNAAKSAASTL SGTAGAAAKVAKIGDRGRGRF
Uniprot No.

Target Background

Function
VirB6 is a component of the type IV secretion system VirB/VirD4, which plays a significant role in the virulence of Bartonella quintana. It is thought to be a key factor in subverting human endothelial cell (HEC) function.
Database Links

KEGG: bqu:BQ10570

STRING: 283165.BQ10570

Protein Families
TrbL/VirB6 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of VirB6 in B. quintana and how does it compare to homologs in other bacteria?

VirB6 in B. quintana is a polytopic inner membrane protein with multiple transmembrane domains. While specific structural data for B. quintana VirB6 is limited, comparative analyses with homologs such as Agrobacterium tumefaciens VirB6 indicate it likely contains multiple membrane-spanning regions that anchor the protein in the bacterial inner membrane .

The protein participates in forming complexes with other T4SS components, particularly VirB7 and VirB9, which are essential for secretion channel and T-pilus formation . Researchers investigating VirB6 structure should consider employing membrane protein topology mapping techniques such as cysteine scanning mutagenesis or PhoA/LacZ fusion analysis to define transmembrane segments and protein orientation.

How does the genomic context of virB6 in B. quintana differ from other Bartonella species?

The virB6 gene in B. quintana is part of the virB2-virB11 operon and functions within the VirB/D4 type IV secretion system . This genetic organization is conserved among Bartonella species, though B. quintana shows evidence of genome reduction compared to B. henselae (1,581,384 bp versus 1,931,047 bp), which may affect regulatory elements and genetic context of the virB operon .

When designing experiments to study virB6 expression or manipulation, researchers should consider these species-specific genomic contexts. Complementation studies between different Bartonella species can help identify functional conservation and divergence of VirB6 proteins. The reduced genome of B. quintana suggests potential adaptation to its specialist human-restricted lifestyle, which may influence virB6 regulation compared to species with broader host ranges .

What is the temperature-dependent expression pattern of virB6 in B. quintana?

B. quintana deploys host and vector temperature-specific transcriptomes, adapting gene expression between human host temperature (37°C) and vector temperature (28°C) . Although specific virB6 expression patterns weren't detailed in the search results, researchers should examine virB6 expression under these different temperature conditions to understand its regulation during the infection cycle.

To study temperature-dependent expression, researchers can employ quantitative RT-PCR or RNA-seq analysis of B. quintana cultures grown at 28°C versus 37°C, focusing on time points during logarithmic growth phase as identified in previous transcriptomic studies . Protein-level analysis using immunoblotting with anti-VirB6 antibodies would complement transcriptional studies to confirm temperature-dependent regulation at the protein level.

How can researchers design effective insertion mutations to study VirB6 functional domains?

Based on studies with other T4SS systems, an effective approach for VirB6 functional analysis is oligonucleotide-directed mutagenesis to introduce in-frame insertions at strategic intervals along the virB6 gene . Researchers have successfully used restriction site insertions (such as NcoI-BamHI or NdeI-BamHI) at approximately 30-codon intervals to create insertion mutations that add short amino acid sequences (like PMGS or HMGS) at specific positions .

When designing such experiments for B. quintana VirB6:

  • Create a detailed topological map of the protein first, identifying predicted transmembrane domains, periplasmic loops, and cytoplasmic regions

  • Target insertions at conserved residues identified through multiple sequence alignments with VirB6 proteins from related species

  • Ensure insertions maintain the reading frame and don't disrupt signal sequences or known functional motifs

  • Include positive controls (wild-type complementation) and negative controls (deletion mutants)

  • Evaluate each mutant for protein stability, membrane localization, and ability to interact with other VirB components

What approaches are most effective for studying VirB6-mediated protein complex formation in B. quintana?

VirB6 participates in forming complexes with other T4SS components, particularly VirB7 and VirB9, which are essential for secretion channel formation . To study these interactions in B. quintana, researchers should consider:

  • Non-reducing SDS-PAGE analysis: This technique can detect disulfide-linked complexes between VirB proteins, particularly VirB7-VirB9 dimers that form with VirB6 participation .

  • Crosslinking studies: Chemical crosslinking followed by immunoprecipitation can capture transient interactions between VirB6 and other components.

  • Bacterial two-hybrid systems: These can assess direct protein-protein interactions in vivo.

  • Co-immunoprecipitation assays: Using antibodies against VirB6 or epitope-tagged versions to pull down interacting partners.

  • Blue native PAGE: This technique preserves protein complexes in their native state and can reveal higher-order assemblies.

When analyzing results, researchers should examine how VirB6 mutations affect complex formation, particularly monitoring for "higher-order VirB9 complexes or aggregates" that have been observed with VirB6 overproduction in other systems .

How can researchers assess the impact of virB6 mutations on T4SS function in B. quintana?

Evaluating T4SS functionality following virB6 mutation requires multiple complementary approaches:

  • Substrate translocation assays: Test whether the system can still deliver effector proteins or DNA to target cells. This could involve creating reporter fusions with T4SS substrates and detecting their delivery to host cells .

  • T-pilus production assessment: Examine formation of the T-pilus structure using electron microscopy or immunofluorescence with anti-pilus antibodies. Interestingly, some VirB6 mutants can translocate substrates even without detectable T-pilus formation .

  • Host cell phenotypic changes: Monitor VirB/D4-dependent phenotypes in infected human endothelial cells, including "inhibition of apoptosis, activation of proinflammatory signaling via NF-κB, modulation of angiogenesis, and reorganization of the actin cytoskeleton" .

  • In vivo infection models: Ultimate validation requires animal infection models to assess if mutants can establish bacteremia, as the VirB/D4 T4SS is "essential for the pathogenicity" of Bartonella species and "is required during colonization of the primary niche rather than for blood-stage infection" .

What are the major difficulties in producing recombinant B. quintana VirB6 protein and how can they be addressed?

Recombinant production of VirB6 presents several challenges due to its nature as a polytopic inner membrane protein:

  • Membrane protein solubility: VirB6 contains multiple transmembrane domains which make it difficult to express in soluble form. Researchers should consider:

    • Using specialized expression systems designed for membrane proteins

    • Creating fusion constructs with solubility-enhancing partners like MBP or SUMO

    • Expressing only specific soluble domains for structural studies

  • Protein toxicity: Overexpression of membrane proteins often exhibits toxicity to host cells. Strategies include:

    • Using tightly regulated expression systems with low basal expression

    • Employing specialized E. coli strains designed for toxic protein expression

    • Optimizing induction conditions with lower inducer concentrations and reduced temperatures

  • Proper folding: Ensuring correct folding of multiple transmembrane segments requires:

    • Expression in membrane-mimetic environments

    • Inclusion of chaperones that facilitate membrane protein folding

    • Selection of appropriate detergents for extraction and purification

  • Functional validation: Confirming that recombinant VirB6 retains functionality through:

    • Complementation assays with virB6-deficient strains

    • In vitro reconstitution of VirB6-dependent complexes

    • Structural analyses to confirm proper folding

How can researchers differentiate between direct and indirect effects of virB6 mutations on T4SS function?

Distinguishing direct from indirect effects of virB6 mutations requires systematic analysis:

  • Protein stability assessment: Mutations may destabilize VirB6, indirectly affecting T4SS assembly. Researchers should quantify protein levels of both VirB6 and other T4SS components in mutant strains.

  • Localization studies: Confirm proper membrane localization of mutant VirB6 proteins using fractionation techniques and immunoblotting or fluorescence microscopy with tagged variants.

  • Interaction mapping: Systematically test interactions between mutant VirB6 and other T4SS components using techniques mentioned in question 2.2.

  • Temporal analysis: Examine the assembly sequence of the T4SS complex in wild-type versus mutant strains to identify where the process fails.

  • Complementation analysis: Test whether defects can be rescued by providing wild-type VirB6 in trans or by overexpressing other T4SS components.

  • Structure-function correlation: Map mutations onto predicted structural models to determine if they affect interface regions or conserved functional domains.

Researchers should pay particular attention to VirB6's role in VirB7-VirB9 complex formation, as some VirB6 mutants create "novel VirB7 and VirB9 complexes detectable by nonreducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis" .

How does B. quintana VirB6 contribute to immune evasion strategies during infection?

While direct evidence linking VirB6 to immune evasion isn't detailed in the search results, the VirB/D4 T4SS system it belongs to plays crucial roles in host immune modulation:

  • The T4SS delivers Bartonella effector proteins (Beps) that manipulate host cell signaling and defense mechanisms . For example, BepD activates the STAT3 pathway and promotes IL-10 secretion, which contributes to immune evasion by suppressing inflammation .

  • VirB6's role in T4SS assembly indirectly contributes to these effects by ensuring proper effector translocation. Its contribution to secretion channel formation is essential for delivering these immunomodulatory effectors.

  • Future research should investigate whether VirB6 has additional roles beyond T4SS assembly that might directly contribute to immune evasion, such as:

    • Potential interactions with host pattern recognition receptors

    • Effects on antigen presentation pathways

    • Influence on TLR signaling, particularly given that Bartonella LPS is poorly recognized by TLR4

Researchers can approach this by comparing host immune responses to wild-type versus virB6-deficient B. quintana strains, focusing on cytokine profiles, immune cell activation, and antigen presentation.

What is the evolutionary significance of VirB6 conservation across Bartonella species with different host specificities?

The conservation of VirB6 across Bartonella species with different host ranges presents an interesting evolutionary question:

  • B. quintana is a human-specific pathogen with a reduced genome compared to more promiscuous species like B. henselae . Despite this genome reduction, B. quintana has maintained the virB6 gene, suggesting strong selective pressure for its retention.

  • VirB/D4 T4SS function is "essential for the pathogenicity" of Bartonella species , indicating that VirB6 plays a critical role in the infection strategy common to specialist and generalist species alike.

  • Researchers should conduct comparative analyses of VirB6 sequences across Bartonella species to:

    • Identify conserved domains that likely perform core functions

    • Detect variable regions that might reflect host adaptation

    • Examine selection pressures on different protein domains

    • Correlate sequence variations with host range differences

  • Experimental approaches could include creating chimeric VirB6 proteins with domains from different Bartonella species and testing their functionality in various host cell types.

This evolutionary analysis could provide insights into how T4SS components contribute to host adaptation and specialization in vector-borne pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.